DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and AT3G02030

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001327586.1 Gene:AT3G02030 / 821242 AraportID:AT3G02030 Length:666 Species:Arabidopsis thaliana


Alignment Length:271 Identity:64/271 - (23%)
Similarity:106/271 - (39%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PNKNYILASFPHGILGTG-ISINMGLDISKWLQLFPQVRPKVATLDQNFLTP--IVRGLLRSWGL 166
            |::..:|....|.:|.:. ||:.......:.:.|.|.|.|.:.:..::.|.|  .|..:||..|.
plant   406 PSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMMFSRLRDGLLPDVSVYDMLRMMGS 470

  Fly   167 VSVSKEALVYLLT-KSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMA 230
            |.:|...|..||: ||:               :.:..||.:|||.....:|.|....:..||:.|
plant   471 VPISGTHLHNLLSAKSH---------------ILLFPGGIREALHRKGEEYKLMWPEKAEFVRAA 520

  Fly   231 IRTGSSIVPTFSFGEVDIL-------DQVANPPNSRVRRFQDFVKRITGISP------------- 275
            .:.|:.|||....||.|.|       ||:      :|...::.:||:|...|             
plant   521 AKFGAKIVPFCGVGEDDFLKVVVDYNDQI------KVPLVKEVLKRVTAEGPEVRGSLEGEEGNQ 579

  Fly   276 ------LIPVGRGIFNYSFGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFA 334
                  :||...|.:.|.||        .::.....::...|:....|.| :.|:|...::  |.
plant   580 DFHMPGVIPKCPGRYYYYFG--------KEIKTGAEELRDRDKAKEVYAD-VKKEVERCIK--FV 633

  Fly   335 KYK---DQYIP 342
            |.:   |.|.|
plant   634 KQRREEDPYRP 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 62/267 (23%)
AT3G02030NP_001327586.1 MhpC 89..347 CDD:223669
LPLAT_MGAT-like 396..>544 CDD:153249 41/152 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.