DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and MOGAT2

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_011543569.1 Gene:MOGAT2 / 80168 HGNCID:23248 Length:336 Species:Homo sapiens


Alignment Length:302 Identity:117/302 - (38%)
Similarity:170/302 - (56%) Gaps:24/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IEWAPKGVPMERRRQTFAMAFLILSFMILSFGSYFFVAAVLFYGSLLWRTIMVIYLVYVYANHKR 67
            :|:||..:|.|||.||.|:...:.||:.|:........|:||  :..| .:.|:|..:.|.:..:
Human     2 VEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLF--TRFW-LLTVLYAAWWYLDRDK 63

  Fly    68 THS----IMDGNGWKINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMG 128
            ...    |.....|.|    |  ::.:||||:.|||||||.|::|||....|||:|..|...|:.
Human    64 PRQGGRHIQAIRCWTI----W--KYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLC 122

  Fly   129 LDISKWLQLFPQVRPKVATLDQNFLTPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGF 193
            .:.:.:..:||.:||.:..|...|..|..|..:.|.|||:..||:..::|          ||.| 
Human   123 TESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHIL----------NRKG- 176

  Fly   194 TSNAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNS 258
            ..|.:.|:|||||||||:.||.:.|.|:||||||::|:..|:.:||.|||||.|:.||:.|...|
Human   177 GGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGS 241

  Fly   259 RVRRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRIVQV 300
            .:|..|:.:::|.|||..:..|||:|.||||.:|.||.|..|
Human   242 WLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 101/255 (40%)
MOGAT2XP_011543569.1 LPLAT 41..297 CDD:302626 103/263 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146801
Domainoid 1 1.000 214 1.000 Domainoid score I2726
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H57020
Inparanoid 1 1.050 235 1.000 Inparanoid score I3400
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8637
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R305
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.