DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and Mogat3

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:XP_001064308.2 Gene:Mogat3 / 685560 RGDID:1592588 Length:84 Species:Rattus norvegicus


Alignment Length:78 Identity:26/78 - (33%)
Similarity:46/78 - (58%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 QDFVKRITGISPLIPVGRGIFNYSFGFL-PNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVID 327
            |:.::||  :|..:|    :|:...|.| |.|..|..||||||.|.:|.:|....|:::|:..::
  Rat     2 QEALQRI--LSVALP----LFHGRLGLLIPFRVPIHTVVGAPIPVQRSPRPTREQVNRLHELYVE 60

  Fly   328 DLEKMFAKYKDQY 340
            .|.::|.::|.:|
  Rat    61 RLTQLFEEHKMRY 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 25/76 (33%)
Mogat3XP_001064308.2 LPLAT <2..83 CDD:418432 26/78 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340445
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.