DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and Mogat1

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001102273.1 Gene:Mogat1 / 363261 RGDID:1311644 Length:183 Species:Rattus norvegicus


Alignment Length:125 Identity:55/125 - (44%)
Similarity:77/125 - (61%) Gaps:4/125 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 NAVAILVGGAQEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRV 260
            |...|::|||:|.|:|.||:|.|.|..||||||:|:..|:.:||.|||||.::..||.||..|.:
  Rat     8 NISVIVIGGAKELLESFPGRYSLCLLQRKGFVKIALTHGAHLVPVFSFGENELYSQVDNPKGSWL 72

  Fly   261 RRFQDFVKRITGISPLIPVGRGIFNYSFGFLPNRRRI--VQVVGAPIDVVQ--SDQPDAA 316
            |..||.|..:||::..:...||||..|||.:|.|:.|  |..||....:.|  :.|.|::
  Rat    73 RTAQDKVYNLTGLALPLFYARGIFQNSFGLMPYRKLIYTVAAVGTAARLTQKSNHQNDSS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 55/125 (44%)
Mogat1NP_001102273.1 LPLAT <1..126 CDD:302626 53/117 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340451
Domainoid 1 1.000 212 1.000 Domainoid score I2683
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 236 1.000 Inparanoid score I3307
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm9114
orthoMCL 1 0.900 - - OOG6_100399
Panther 1 1.100 - - LDO PTHR12317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X186
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.