DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and Awat1

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001074605.1 Gene:Awat1 / 245533 MGIID:3588200 Length:328 Species:Mus musculus


Alignment Length:323 Identity:116/323 - (35%)
Similarity:172/323 - (53%) Gaps:19/323 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LSFGSYFFVAAVLFYGSL---LWRTIMVIYLVYVYANHKRTHSIMDGNGWKINRNNWLFRHYRDY 92
            ||:.:.|::...|....|   || .:..:|.|::..:.|........:.|..|.|.|  .|.|||
Mouse    20 LSYVAMFWIVQPLLICLLFTPLW-PLPTVYFVWLLLDWKTPDKGGRRSDWVRNWNVW--NHIRDY 81

  Fly    93 FPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVRPKVATLDQNFLTPIV 157
            ||:.::||.:|.|::|||:...|||:|..|...|...:.:.:.:.||.:.|.:|||...|..||:
Mouse    82 FPITILKTKDLSPSENYIMGVHPHGLLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPII 146

  Fly   158 RGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGAQEALDSHPGKYILTLKN 222
            |..:.:.||.|||:.::.|||:..            |.|.|.|:|||..|||.|.|....|.||.
Mouse   147 RDYIMAKGLCSVSQASIDYLLSHG------------TGNLVGIVVGGVGEALQSVPNTTTLLLKK 199

  Fly   223 RKGFVKMAIRTGSSIVPTFSFGEVDILDQVANPPNSRVRRFQDFVKRITGISPLIPVGRGIFNYS 287
            |||||:.|::.|:.:||||:|||.::.|||....:||:.:||...:||.|....:..|:|.....
Mouse   200 RKGFVRTALQHGAHLVPTFTFGETEVYDQVLFHEDSRMFKFQSLFRRIFGFYCCVFYGQGFHQDC 264

  Fly   288 FGFLPNRRRIVQVVGAPIDVVQSDQPDAAYVDKIHKQVIDDLEKMFAKYKDQYIPNSKQDKLI 350
            .|.||..:.|:.|||..:.:.|...|....|||.|...:|.|.|:|.::|.||..::.| |||
Mouse   265 KGLLPYHKPIITVVGEALPLPQVKNPSPEIVDKYHALYMDALYKLFEQHKVQYGCSNTQ-KLI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 104/289 (36%)
Awat1NP_001074605.1 LPLAT 36..327 CDD:302626 112/307 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836756
Domainoid 1 1.000 217 1.000 Domainoid score I2664
eggNOG 1 0.900 - - E1_KOG0831
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 242 1.000 Inparanoid score I3298
Isobase 1 0.950 - 0 Normalized mean entropy S1864
OMA 1 1.010 - - QHG53531
OrthoDB 1 1.010 - - D1347007at2759
OrthoFinder 1 1.000 - - FOG0000289
OrthoInspector 1 1.000 - - mtm8869
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12317
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X186
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.820

Return to query results.
Submit another query.