DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1941 and TMEM68

DIOPT Version :9

Sequence 1:NP_001286161.1 Gene:CG1941 / 35718 FlyBaseID:FBgn0033214 Length:352 Species:Drosophila melanogaster
Sequence 2:NP_001273586.1 Gene:TMEM68 / 137695 HGNCID:26510 Length:324 Species:Homo sapiens


Alignment Length:232 Identity:55/232 - (23%)
Similarity:91/232 - (39%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LSFGSYF---FVAAVLFYGSLLWRTIMVIYLVYVYAN-HKR--------THSIMDG------NGW 77
            |:|.:|.   |...:|..  |.:.||.::||..::.: :||        :|::.||      ..|
Human    38 LNFANYLLWVFTPLILLI--LPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLW 100

  Fly    78 KINRNNWLFRHYRDYFPVQLVKTAELPPNKNYILASFPHGILGTGISINMGLDISKWLQLFPQVR 142
            ..:...|   |..:      |...|..|.....|..|.||    .|.|:....::|   :|....
Human   101 DGHAAVW---HGYE------VHGMEKIPEDGPALIIFYHG----AIPIDFYYFMAK---IFIHKG 149

  Fly   143 PKVATLDQNFL--TPIVRGLLRSWGLVSVSKEALVYLLTKSNDPKHKDNRDGFTSNAVAILVGGA 205
            .....:..:|:  .|....||..:..:...:|..|.:|           |.|   :.:||..||.
Human   150 RTCRVVADHFVFKIPGFSLLLDVFCALHGPREKCVEIL-----------RSG---HLLAISPGGV 200

  Fly   206 QEALDSHPGKYILTLKNRKGFVKMAIRTGSSIVPTFS 242
            :|||.|.. .|.:...:|:||.::||.....|:|.|:
Human   201 REALISDE-TYNIVWGHRRGFAQVAIDAKVPIIPMFT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1941NP_001286161.1 LPLAT 50..340 CDD:302626 49/210 (23%)
TMEM68NP_001273586.1 LPLAT_MGAT-like 103..310 CDD:153249 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.