DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tor and Tie

DIOPT Version :9

Sequence 1:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:667 Identity:133/667 - (19%)
Similarity:211/667 - (31%) Gaps:320/667 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 PKITVLGSHFEVHLV--AQSAGGKNVSGLTL-DKVHRGVLLSEGNMVKLVLFI--IVPICCILML 414
            |.:|...:...:.:|  :.||...::|...: ::....:.:...|:|.|||..  ::|:..|::.
  Fly   682 PAVTAPSNEVYIGIVESSSSASPADISSTVIANERDLNMEMRRMNLVTLVLVAVGVIPLAAIILY 746

  Fly   415 CSLTFCRRNR---SEV------------------------------------------------- 427
            ....|..|.|   |||                                                 
  Fly   747 LVRNFVIRRRAKQSEVFDVCITDQQPISPVKKVDSKYQVDDDEDEVDHQHHQHMQHHQNHQNHQN 811

  Fly   428 ----------QALQMDA----------KDAKASEFHLSLMDSSGLLVTLSANESLEVMDELEVEP 472
                      ||.|.||          |.:.|||||                         :.|.
  Fly   812 HQHHQAMPMSQASQRDANHNRYGNNDDKTSLASEFH-------------------------DFER 851

  Fly   473 HSVLLQDVLGEGAFGLVRR-------GVY-KKRQVAVKL---------LKDEPNDEDVYAFKCEI 520
            .::.|:.:||||.||.|.:       |.: ..|.||||.         ||||.|           
  Fly   852 SNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRIVAVKTIRACSAQVSLKDEAN----------- 905

  Fly   521 QMLKAVGKHPNIVGIVGYSTRFSNQMMLLIEYCSLGSLQNFLREEWKFRQEQNAIGLKKNLEQNV 585
             :::.:|.|.|:|.::|.... |...||::||...|.|.:.||                      
  Fly   906 -IMRKLGSHQNVVTLLGACVE-SEPHMLIMEYAMRGRLLSLLR---------------------- 946

  Fly   586 DNRRFNRLPRNSIHDRIEDINNSMLSTVEEESESDQTHSSRCETYTLTRITNAADNKGYGLEDIE 650
                                                  ::|..|..|                  
  Fly   947 --------------------------------------AARSATNIL------------------ 955

  Fly   651 NIGGSYIPKTAEAPKDRPKRKLKPQPKKDSKQDFKSDNKKRIFENKEYFDCLDSSDTKPRIPLKY 715
                     .|..|..|....|.|:                                        
  Fly   956 ---------PASVPGGRSLAPLSPR---------------------------------------- 971

  Fly   716 ADLLDIAQQVAVGMEFLAQNKVVHRDLAARNVLISVDRSIKIADFGLSRDV-------------- 766
             .|...|..:|.|||::|..::|||||||||||:..:...||.|||:|.|:              
  Fly   972 -TLAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNGMCKICDFGMSIDLDAERMRKEQEKNAA 1035

  Fly   767 ----------------------YHENVYRKSGGSG------------------------KLPIKW 785
                                  :.::.:.:..|.|                        .|||:|
  Fly  1036 NDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIRW 1100

  Fly   786 LALESLTHQVYTSQSDVWSFGVLLYEITTLGGMPYPSVSPSDLLQLLRQGHRMKRPEGCTQEMFS 850
            :|.|||.:.::|:::|:|:||::|:||.|||..||..::..::::.:.||.|...|:....|.::
  Fly  1101 MAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFYN 1165

  Fly   851 LMESCWSSVPSHRPTFS 867
            ||..||...|..||:|:
  Fly  1166 LMSRCWHKEPHMRPSFA 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
torNP_476762.1 FN3 199..261 CDD:214495
STYKc 475..873 CDD:214568 102/470 (22%)
PTKc 479..873 CDD:270623 101/466 (22%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 102/470 (22%)
PTKc 860..1187 CDD:270623 101/464 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.