DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tor and KIT

DIOPT Version :9

Sequence 1:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_001372213.1 Gene:KIT / 3815 HGNCID:6342 Length:977 Species:Homo sapiens


Alignment Length:917 Identity:221/917 - (24%)
Similarity:337/917 - (36%) Gaps:315/917 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 KVQENYQMNMICRTESEIVFQIDWVQHSRGTEPAPNATYIIRVDAVKDD--------------NK 122
            |:||.|.               .|  |.........||..|....|.|.              |.
Human   255 KLQEKYN---------------SW--HHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSANV 302

  Fly   123 ETALYLSDDNFL-ILPGLESNSTHNITALAMHGDG-----SYSLIAK---------DQTFATLIR 172
            .|.|.:.|..|: |.|.:      |.|.....|:.     .|....|         ::||.....
Human   303 TTTLEVVDKGFINIFPMI------NTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE 361

  Fly   173 GYQPSKMGAVNLLRFVPQPDDLHHIAAEIEWKPSAESNCYFDMVSYSTNSVNMDEPLEVQFRDRK 237
            .| |......| :|:|   .:||     :......|...|..:||      |.|....:.|    
Human   362 DY-PKSENESN-IRYV---SELH-----LTRLKGTEGGTYTFLVS------NSDVNAAIAF---- 406

  Fly   238 KLYRHT-VDNLEFDKQYHVGVRTVNIMNRLESDLQWLPIAVPS-CLDWYPYNYTLCPPHKPENLT 300
            .:|.:| .:.|.:|       |.||.|      ||.:....|. .:|||     .||.       
Human   407 NVYVNTKPEILTYD-------RLVNGM------LQCVAAGFPEPTIDWY-----FCPG------- 446

  Fly   301 VTQKQYLPNILALNITWARPRYLPDNYTLHIFDLFKGGTELNYTLDQNRSHF--YVPKITVLGSH 363
             |:::...::|.:::                           .||:.:...|  .|.:.::..|.
Human   447 -TEQRCSASVLPVDV---------------------------QTLNSSGPPFGKLVVQSSIDSSA 483

  Fly   364 FE----VHLVAQSAGGKN-------VSGLTLDKVHRGVLLSEGNMVKLVLFIIVP--ICCILMLC 415
            |:    |...|.:..||.       ..|...:::|...|.:.    .|:.|:||.  :|.|:|:.
Human   484 FKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTP----LLIGFVIVAGMMCIIVMIL 544

  Fly   416 SLTFCRRNRSEVQALQMDAKDAKASEFHLSLMDSSGLLVTLSANESLEVMDELE------VEP-- 472
            :..:.::...|||                                 .:|::|:.      ::|  
Human   545 TYKYLQKPMYEVQ---------------------------------WKVVEEINGNNYVYIDPTQ 576

  Fly   473 -----------HSVLLQDVLGEGAFGLV----RRGVYKK---RQVAVKLLKDEPNDEDVYAFKCE 519
                       :.:.....||.||||.|    ..|:.|.   ..||||:||...:..:..|...|
Human   577 LPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSE 641

  Fly   520 IQMLKAVGKHPNIVGIVGYSTRFSNQMMLLIEYCSLGSLQNFLREEWK----FRQEQNA-IGLKK 579
            :::|..:|.|.|||.::|..| .....:::.|||..|.|.||||.:..    .:||.:| ..|.|
Human   642 LKVLSYLGNHMNIVNLLGACT-IGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYK 705

  Fly   580 NLEQNVDNRRFNRLPRNSIHDRIEDINNSMLSTVEEESESDQTHSSRCETYTLTRITNAADNKGY 644
            ||                :|.:             |.|.||.|:             ...|.|. 
Human   706 NL----------------LHSK-------------ESSCSDSTN-------------EYMDMKP- 727

  Fly   645 GLEDIENIGGSYIPKTAEAPKDRPKRKLKPQPKKDSKQDFKSDNKKRIFENKEYFDCLDSSDTKP 709
                    |.||:..|                        |:| |:|......|.:    .|..|
Human   728 --------GVSYVVPT------------------------KAD-KRRSVRIGSYIE----RDVTP 755

  Fly   710 RI------PLKYADLLDIAQQVAVGMEFLAQNKVVHRDLAARNVLISVDRSIKIADFGLSRDVYH 768
            .|      .|...|||..:.|||.||.|||....:||||||||:|::..|..||.||||:||:.:
Human   756 AIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKN 820

  Fly   769 ENVYRKSGGSGKLPIKWLALESLTHQVYTSQSDVWSFGVLLYEITTLGGMPYPSVS-PSDLLQLL 832
            ::.|... |:.:||:||:|.||:.:.|||.:|||||:|:.|:|:.:||..|||.:. .|...:::
Human   821 DSNYVVK-GNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMI 884

  Fly   833 RQGHRMKRPEGCTQEMFSLMESCWSSVPSHRPTFSALKHRLGGMILATNDVPERLKQLQAATE-- 895
            ::|.||..||....||:.:|::||.:.|..||||..:...:.             ||:..:|.  
Human   885 KEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIE-------------KQISESTNHI 936

  Fly   896 -SKLKSC 901
             |.|.:|
Human   937 YSNLANC 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
torNP_476762.1 FN3 199..261 CDD:214495 12/62 (19%)
STYKc 475..873 CDD:214568 132/416 (32%)
PTKc 479..873 CDD:270623 132/412 (32%)
KITNP_001372213.1 Ig strand A 212..215 CDD:409353
ig 216..306 CDD:395002 13/67 (19%)
Ig strand B 229..239 CDD:409353
Ig strand C' 250..252 CDD:409353
Ig strand D 260..263 CDD:409353 1/17 (6%)
Ig strand E 267..280 CDD:409353 3/12 (25%)
Ig strand F 287..294 CDD:409353 0/6 (0%)
Ig strand G 300..308 CDD:409353 3/7 (43%)
IgI_4_SCFR 312..412 CDD:409446 25/125 (20%)
Ig strand B 332..336 CDD:409446 0/3 (0%)
Ig strand C 346..350 CDD:409446 0/3 (0%)
Ig strand E 376..380 CDD:409446 2/8 (25%)
Ig strand F 390..395 CDD:409446 1/4 (25%)
Ig strand G 403..406 CDD:409446 0/2 (0%)
Ig 427..503 CDD:409353 20/115 (17%)
Ig strand C 438..442 CDD:409353 1/3 (33%)
Ig strand E 471..479 CDD:409353 1/7 (14%)
Ig strand F 489..494 CDD:409353 1/4 (25%)
PTKc_Kit 554..929 CDD:270682 139/502 (28%)
Important for interaction with phosphotyrosine-binding proteins 569..571 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.