DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tor and CG10702

DIOPT Version :9

Sequence 1:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:457 Identity:91/457 - (19%)
Similarity:157/457 - (34%) Gaps:150/457 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DKISHDKTLLNVTACTQNCLE---------------KGQMDFRSCLKDCRINGTFPGALRKVQEN 76
            :.:::.|.  |:.||.:.||.               :|..|...|:|.|..:       :.|.||
  Fly   199 ENVANPKA--NINACHEECLGGCKNNSSSPADCSVCRGLSDDGVCVKSCPKD-------KYVMEN 254

  Fly    77 YQMNMICRTESEIVFQIDWV-QHSRGTEPAPNATYIIRVDAVKDDNKETALYLSDDNFLI----- 135
            ||.   |.|::|.|.:..:| ..|:.....|:        ..|.:|:...:..|.|...|     
  Fly   255 YQR---CYTKAECVLKHGYVISGSQCVAFCPS--------GYKTNNRSECVLCSPDEACISFCTP 308

  Fly   136 -LPGLESNSTHNIT-ALAMHG----DGSYSLIAKD--------QTFATL--IRG----YQPSKMG 180
             .|| ::.:.:|:. |..:.|    :||..:..::        |:|.::  :||    |:.|::.
  Fly   309 EWPG-KAFTVYNLADAENLRGCQIFNGSLVITIRNKVNETQLYQSFTSMREVRGHVKVYRSSQLR 372

  Fly   181 AVNLLRFVPQ----PDDLHHIA---------AEIEWKPSAESN--------------CYFDMVSY 218
            ::..||.:.:    |.:..|.:         :|: |.||.:..              |...|..:
  Fly   373 SLQFLRNLERVHGDPLENRHYSFILYDNKELSEL-WTPSRQLEFMEGGMFMHRNNKLCNRRMREF 436

  Fly   219 STNSVNMDEPLE-VQFRDRKKLYRHTVDNLEFDKQYHVGVRTVNIMNRLESDLQWLPIAVPSCLD 282
            . |:|..|..|: :|..|::.........|...|:.|..|:           |.||.......::
  Fly   437 Q-NAVTHDRALDSLQTNDQEVQCSPLKLQLYVQKRTHRSVK-----------LSWLKSQTSQKIE 489

  Fly   283 WYPYNYTLCPPHKPENLTVTQKQY-----LPNILALNITWARPRYLPD----NYTLHIFDL---- 334
            ..         |:|   .:..|.|     |...:...|.|.|....||    |.|.::|||    
  Fly   490 LI---------HRP---LLPGKLYHEESELDAPICTRINWKRRLLFPDDLIENGTHYLFDLDDLQ 542

  Fly   335 --------------------FKGGTELNYTLDQNRSHFYVPKITVLGSHFEVHLVAQSAGGKNVS 379
                                ::..:||.|.  |.......|.:..|....:..|..|.|...:||
  Fly   543 PDTRYVVLLRTFGNDEAHEAYEARSELTYV--QTELDIPKPPLLELVKKTDSSLTVQMASHDHVS 605

  Fly   380 GL 381
            .|
  Fly   606 FL 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
torNP_476762.1 FN3 199..261 CDD:214495 16/76 (21%)
STYKc 475..873 CDD:214568
PTKc 479..873 CDD:270623
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142 25/117 (21%)
FU 210..258 CDD:238021 14/57 (25%)
Recep_L_domain 328..441 CDD:279382 20/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.