DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tor and F59F5.3

DIOPT Version :9

Sequence 1:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_509765.2 Gene:F59F5.3 / 186634 WormBaseID:WBGene00010342 Length:681 Species:Caenorhabditis elegans


Alignment Length:361 Identity:89/361 - (24%)
Similarity:141/361 - (39%) Gaps:91/361 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   577 LKKNLEQNVDNRRFNRLPRNSIHD-RIEDINNSMLSTVEEESESDQTHSSRCETYTLTRITNAAD 640
            |.|:|.||    .:|::....:.: |||::||        :|:....:||...|..:.:......
 Worm   339 LTKSLRQN----NYNKVSTTDVRETRIEELNN--------KSKLGVGNSSTIYTAEICKTKKCIV 391

  Fly   641 NKGYGLEDIENIGGSYIPKTAEAPKD--------------RPKRK-----------LKPQPKKDS 680
            .|       |::..|:..|..:..|.              :|::|           |.|..:|..
 Worm   392 IK-------ESVRKSHCTKELKLLKSLKHPNIITPLGVIVQPEQKTCFNVQIRQHLLLPYYQKTC 449

  Fly   681 KQDF--KSDNKKR----IFENKEYFDCLDSSDTKPRIPLKYADLLDIAQQVAVGMEFLAQNKVVH 739
            .:.:  |....||    ||...|        .|.|...:...||:.||.|||..:|:|...::.|
 Worm   450 LETYIHKFYPPKRGGNNIFHTNE--------ATVPEEEITMFDLVSIAWQVASALEYLKGMEITH 506

  Fly   740 RDLAARNVLISVDRSIKIADF------GLSRDVYHENVYR---KSGGSGKLPIKWLALESLTHQV 795
            ||:|.||||||.::..||.||      ..:|.:..|...:   |:..|..:| |....|.|....
 Worm   507 RDVAMRNVLISNNKVCKITDFERAKKGETTRKISIEKKIKEILKAHMSKDIP-KEYPNECLKGVY 570

  Fly   796 YTSQSDVWSFGVLLYEITTL-----GGMPYPSVSPSDLLQLLRQGHRMKRPEGCTQEMFSLMESC 855
            |...|:|:.||.|:..:.:.     .|..||.:                :||.|.:.::.|:..|
 Worm   571 YYYSSEVYCFGRLMLCLFSFMKPCDYGRIYPPI----------------QPENCPKAIYDLIVDC 619

  Fly   856 WSSVPSHRPTFSALKHRLGGMILATNDVPERLKQLQ 891
            .:.....||:.|:.|..| ..:|...|..|.||..|
 Worm   620 INENRKSRPSISSCKDVL-STVLKHMDHDEFLKLKQ 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
torNP_476762.1 FN3 199..261 CDD:214495
STYKc 475..873 CDD:214568 82/341 (24%)
PTKc 479..873 CDD:270623 82/341 (24%)
F59F5.3NP_509765.2 Pkinase_Tyr <413..637 CDD:369480 62/248 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.