DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tor and Fgfrl1

DIOPT Version :10

Sequence 1:NP_476762.1 Gene:tor / 35717 FlyBaseID:FBgn0003733 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:191 Identity:50/191 - (26%)
Similarity:71/191 - (37%) Gaps:66/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LYLSDDNFLILPGLESNSTHNITALAMHGDGSYSLIAKD---QTFATLIRGYQPSKM-------- 179
            |.:.||   |.||.||           .|.|..|...:|   |.:|. .|..|||||        
Mouse   110 LIIMDD---ISPGKES-----------PGPGGSSGGQEDPASQQWAR-PRFTQPSKMRRRVIARP 159

  Fly   180 -GAVNLLRFV----PQPD--------DLHHIAA----EIEW-------KPSAESNCYFDMVSYST 220
             |:...|:.|    |:||        .|.|:.|    :.:|       ||. :|..|...||...
Mouse   160 VGSSVRLKCVASGHPRPDIMWMKDDQTLTHLEASEHRKKKWTLSLKNLKPE-DSGKYTCRVSNKA 223

  Fly   221 NSVNMDEPLEVQFRDRKK---LYRHTVD-NLEFDKQYHVGVRTVNIMNRLESD----LQWL 273
            .::|....::|..|.|.|   ...|.|: .::|.       .|.:...::.||    :|||
Mouse   224 GAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFG-------GTTSFQCKVRSDVKPVIQWL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
torNP_476762.1 PTKc 479..873 CDD:270623
Fgfrl1NP_473412.1 I-set 29..112 CDD:400151 1/1 (100%)
Ig strand B 43..47 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 78..82 CDD:409353
Ig strand F 92..97 CDD:409353
Ig strand G 105..108 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 15/46 (33%)
IgI_2_FGFRL1-like 143..234 CDD:409442 23/91 (25%)
Ig strand A 143..146 CDD:409442 1/2 (50%)
Ig strand A' 154..159 CDD:409442 0/4 (0%)
Ig strand B 163..171 CDD:409442 2/7 (29%)
Ig strand C 177..182 CDD:409442 1/4 (25%)
Ig strand C' 185..187 CDD:409442 0/1 (0%)
Ig strand D 193..196 CDD:409442 0/2 (0%)
Ig strand E 200..205 CDD:409442 1/4 (25%)
Ig strand F 214..221 CDD:409442 2/6 (33%)
Ig strand G 224..234 CDD:409442 1/9 (11%)
Ig 242..350 CDD:472250 9/43 (21%)
Ig strand B 260..264 CDD:409353 0/3 (0%)
Ig strand C 273..277 CDD:409353 1/3 (33%)
Ig strand E 317..321 CDD:409353
Ig strand F 331..336 CDD:409353
Ig strand G 344..347 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.