| Sequence 1: | NP_001260788.1 | Gene: | LRR / 35715 | FlyBaseID: | FBgn0033212 | Length: | 1486 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_002930.2 | Gene: | RNH1 / 6050 | HGNCID: | 10074 | Length: | 461 | Species: | Homo sapiens |
| Alignment Length: | 339 | Identity: | 87/339 - (25%) |
|---|---|---|---|
| Similarity: | 135/339 - (39%) | Gaps: | 61/339 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 221 IVSALEYNTFFRGLKAAHMRLSHETLERILHVLKRS-MWLEELHLEALGLRWDFLNKLSISVITN 284
Fly 285 SNPAIRTIDLSHNIIEDKGASSLCALFGKIVQGAIHLAGPIAKVSKGLCKLALAHCGLTSKGVNQ 349
Fly 350 MSHSLTLNQSISNSLTYLDLSGNSLKDDITN-LHNFLAQPNV-LEHLDLASTDITLENLFGALLR 412
Fly 413 GCATH----------LAHLNVSHNSFSTKKGKEI------PPSFKQFFTSTFSLKHLNIAGCKLP 461
Fly 462 MEALKNLLLGLACNESTAGLYLDLSSNTLGAQG-AHVLESCIHGVRVLQSLDISDNNLDAELAPV 525
Fly 526 LTAISKN-PSIRTL 538 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| LRR | NP_001260788.1 | LRR_RI | 198..516 | CDD:238064 | 79/314 (25%) |
| leucine-rich repeat | 289..331 | CDD:275381 | 10/41 (24%) | ||
| leucine-rich repeat | 332..352 | CDD:275381 | 7/19 (37%) | ||
| leucine-rich repeat | 364..389 | CDD:275380 | 8/25 (32%) | ||
| leucine-rich repeat | 391..417 | CDD:275380 | 6/25 (24%) | ||
| leucine-rich repeat | 418..449 | CDD:275380 | 7/36 (19%) | ||
| LRR_RI | 441..>656 | CDD:238064 | 28/100 (28%) | ||
| leucine-rich repeat | 450..467 | CDD:275380 | 4/16 (25%) | ||
| leucine-rich repeat | 468..503 | CDD:275380 | 14/35 (40%) | ||
| leucine-rich repeat | 508..534 | CDD:275380 | 7/26 (27%) | ||
| leucine-rich repeat | 535..564 | CDD:275380 | 1/4 (25%) | ||
| leucine-rich repeat | 570..596 | CDD:275380 | |||
| leucine-rich repeat | 597..618 | CDD:275380 | |||
| CARMIL_C | 797..1108 | CDD:292619 | |||
| RNH1 | NP_002930.2 | 2 X 5 AA tandem repeats of S-L-D-I-Q | 2..11 | ||
| LRR_RI | 6..325 | CDD:238064 | 49/182 (27%) | ||
| leucine-rich repeat | 6..29 | CDD:275380 | |||
| LRR 1 | 20..48 | ||||
| leucine-rich repeat | 30..57 | CDD:275380 | |||
| LRR 2 | 49..76 | ||||
| leucine-rich repeat | 58..86 | CDD:275380 | |||
| LRR 3 | 77..105 | ||||
| leucine-rich repeat | 87..114 | CDD:275380 | |||
| LRR 4 | 106..133 | ||||
| leucine-rich repeat | 115..143 | CDD:275380 | |||
| LRR 5 | 134..162 | 87/339 (26%) | |||
| leucine-rich repeat | 144..171 | CDD:275380 | 2/8 (25%) | ||
| LRR 6 | 163..190 | 4/26 (15%) | |||
| leucine-rich repeat | 172..200 | CDD:275380 | 5/27 (19%) | ||
| LRR 7 | 191..219 | 11/29 (38%) | |||
| leucine-rich repeat | 201..228 | CDD:275380 | 10/28 (36%) | ||
| LRR 8 | 220..247 | 7/26 (27%) | |||
| leucine-rich repeat | 229..257 | CDD:275380 | 10/41 (24%) | ||
| LRR 9 | 248..276 | 11/41 (27%) | |||
| leucine-rich repeat | 258..278 | CDD:275380 | 7/19 (37%) | ||
| LRR 10 | 277..304 | 8/30 (27%) | |||
| leucine-rich repeat | 286..314 | CDD:275380 | 9/31 (29%) | ||
| LRR 11 | 305..333 | 8/36 (22%) | |||
| leucine-rich repeat | 315..338 | CDD:275380 | 7/31 (23%) | ||
| LRR 12 | 334..361 | 4/26 (15%) | |||
| LRR_RI | 340..367 | CDD:197686 | 5/26 (19%) | ||
| leucine-rich repeat | 343..367 | CDD:275380 | 5/23 (22%) | ||
| LRR 13 | 362..390 | 6/36 (17%) | |||
| leucine-rich repeat | 372..399 | CDD:275380 | 7/26 (27%) | ||
| LRR 14 | 391..418 | 11/28 (39%) | |||
| LRR_RI | 397..424 | CDD:197686 | 12/28 (43%) | ||
| LRR 15 | 419..447 | 6/27 (22%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165142532 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||