DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment LRR and LOC101883470

DIOPT Version :9

Sequence 1:	NP_001260788.1	Gene:	LRR / 35715	FlyBaseID:	FBgn0033212	Length:	1486	Species:	Drosophila melanogaster
Sequence 2:	XP_021323876.1	Gene:	LOC101883470 / 101883470	-ID:	-	Length:	85	Species:	Danio rerio

Alignment Length:	77	Identity:	34/77 - (44%)
Similarity:	45/77 - (58%)	Gaps:	0/77 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MSTRSQLTKDLNESVKSILGRHTKILVKYMVKLETKGDKTENRVLVFTPVRVYLLSAKVPTKIEC 65
            ||..|.:.:||.|||:..:|...|:.....|.||.||||.|:|||...|.||:|||.:||.|::.
Zfish     1 MSGDSDVPQDLRESVQDAVGLQLKVCFLKKVNLEVKGDKLESRVLALAPHRVFLLSTRVPAKVDQ 65

  Fly    66 HFHYLDIVGVES 77
            .|...||..:.|
Zfish    66 SFSVFDIQSISS 77

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
LRR	NP_001260788.1	LRR_RI	198..516	CDD:238064
		leucine-rich repeat	289..331	CDD:275381
		leucine-rich repeat	332..352	CDD:275381
		leucine-rich repeat	364..389	CDD:275380
		leucine-rich repeat	391..417	CDD:275380
		leucine-rich repeat	418..449	CDD:275380
		LRR_RI	441..>656	CDD:238064
		leucine-rich repeat	450..467	CDD:275380
		leucine-rich repeat	468..503	CDD:275380
		leucine-rich repeat	508..534	CDD:275380
		leucine-rich repeat	535..564	CDD:275380
		leucine-rich repeat	570..596	CDD:275380
		leucine-rich repeat	597..618	CDD:275380
		CARMIL_C	797..1108	CDD:292619
LOC101883470	XP_021323876.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170575241
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930