| Sequence 1: | NP_610315.1 | Gene: | U2A / 35713 | FlyBaseID: | FBgn0033210 | Length: | 265 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001292510.1 | Gene: | LRMDA / 83938 | HGNCID: | 23405 | Length: | 226 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 66/233 - (28%) |
|---|---|---|---|
| Similarity: | 94/233 - (40%) | Gaps: | 67/233 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 MQYI-NPCRERELDLRGYKIPQIENLGATLDQF-DTIDLSDNDLRK--------------LDN-- 59
Fly 60 ------LPHLPRLKCLLLNNNRIL---RISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKL 115
Fly 116 ETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAA---QEFFRTKQGKDVLKEISRK 177
Fly 178 SKM------SAAAAIAAEAG-NGK------GRGSEGGR 202 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| U2A | NP_610315.1 | LRR_9 | 1..175 | CDD:258718 | 56/191 (29%) |
| leucine-rich repeat | 22..43 | CDD:275380 | 5/20 (25%) | ||
| LRR_4 | 46..81 | CDD:289563 | 21/59 (36%) | ||
| leucine-rich repeat | 46..65 | CDD:275378 | 12/40 (30%) | ||
| leucine-rich repeat | 66..89 | CDD:275378 | 9/25 (36%) | ||
| leucine-rich repeat | 90..114 | CDD:275378 | 6/23 (26%) | ||
| LRMDA | NP_001292510.1 | LRR_RI | <27..>113 | CDD:238064 | 29/89 (33%) |
| leucine-rich repeat | 34..54 | CDD:275378 | 6/19 (32%) | ||
| LRR_8 | 53..112 | CDD:290566 | 20/58 (34%) | ||
| LRR_4 | 54..93 | CDD:289563 | 15/38 (39%) | ||
| leucine-rich repeat | 55..76 | CDD:275378 | 6/20 (30%) | ||
| leucine-rich repeat | 77..103 | CDD:275378 | 9/25 (36%) | ||
| leucine-rich repeat | 104..142 | CDD:275378 | 12/50 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1644 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||