DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and U2A'

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_172447.1 Gene:U2A' / 837505 AraportID:AT1G09760 Length:249 Species:Arabidopsis thaliana


Alignment Length:242 Identity:109/242 - (45%)
Similarity:153/242 - (63%) Gaps:15/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPR 65
            |||||.:||.:|..:.|..:||||||||.|||.|||||||.|||||||||||::.||:|.|:|.|
plant     1 MVKLTADLIWKSPHFFNAIKERELDLRGNKIPVIENLGATEDQFDTIDLSDNEIVKLENFPYLNR 65

  Fly    66 LKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPN 130
            |..||:|||||.||:..|.|.:|.|.|::||.|.|..|.:::||....||:.:.||.|.::.|.|
plant    66 LGTLLINNNRITRINPNLGEFLPKLHSLVLTNNRLVNLVEIDPLASIPKLQYLSLLDNNITKKAN 130

  Fly   131 YREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRK--SKMSAAAAIAAEAGNG 193
            ||.|:.:|...||:|||.|||.|:|..|...|.:|:.::.:|::||:  .|:|..|         
plant   131 YRLYVIHKLKSLRVLDFIKIKAKERAEAASLFSSKEAEEEVKKVSREEVKKVSETA--------- 186

  Fly   194 KGRGSEGGRLANP--QDMQRIREAIKRASSLAEVERLSQILQSGQLP 238
              ...|..::..|  :.:..|:.||..:.::.|:.||.|.|:.||:|
plant   187 --ENPETPKVVAPTAEQILAIKAAIINSQTIEEIARLEQALKFGQVP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 91/173 (53%)
leucine-rich repeat 22..43 CDD:275380 17/20 (85%)
LRR_4 46..81 CDD:289563 23/34 (68%)
leucine-rich repeat 46..65 CDD:275378 12/18 (67%)
leucine-rich repeat 66..89 CDD:275378 12/22 (55%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
U2A'NP_172447.1 LRR_9 1..175 CDD:373143 91/173 (53%)
leucine-rich repeat 22..39 CDD:275378 14/16 (88%)
leucine-rich repeat 40..65 CDD:275378 17/24 (71%)
leucine-rich repeat 66..89 CDD:275378 12/22 (55%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
leucine-rich repeat 115..126 CDD:275378 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1644
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2325
Inparanoid 1 1.050 190 1.000 Inparanoid score I1384
OMA 1 1.010 - - QHG54461
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 1 1.000 - - FOG0005778
OrthoInspector 1 1.000 - - oto4219
orthoMCL 1 0.900 - - OOG6_102567
Panther 1 1.100 - - LDO PTHR10552
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4167
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.