DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and AT3G50690

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_190638.1 Gene:AT3G50690 / 824233 AraportID:AT3G50690 Length:447 Species:Arabidopsis thaliana


Alignment Length:229 Identity:50/229 - (21%)
Similarity:96/229 - (41%) Gaps:33/229 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ATLDQFDT---IDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRISEGLEEA-VPNLGSIILTGNN 99
            :.|::|..   :.:::..:..|:..|.|..|:.|:|::|||....|.|.|| :.:...:.|:.|.
plant    42 SVLEKFQNLQHLSVANIGVSSLEQFPRLGNLQKLILSDNRITVGLEFLVEAGLDSFCDLDLSNNR 106

  Fly   100 LQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRT 164
            :|.:.||.||... ||.::.|...||:...:||..:......|:.||....:..:|..:.:....
plant   107 IQFVEDLAPLAEL-KLVSLDLYECPVTRLKDYRSRVFGLIKTLKYLDKTDAEGNERPESDDEDDE 170

  Fly   165 KQGKDVLKEISRKSKMSAAAAIAAEAGNGKGRG---SEGGRLANPQDMQRIREAIKRASSLAEVE 226
            :..:|..:|.....:         :.|:|:..|   :|..|::|...        :|...:.:|:
plant   171 EDEEDEEEEEEGDEE---------DPGSGEIDGDERAEAPRMSNGHS--------ERVDGVVDVD 218

  Fly   227 RLSQILQSGQLPDKFQHEME-AVAQNGAGHNGSG 259
                   ..:..|....|.| |...||..:..:|
plant   219 -------EDEESDAEDDESEQATGVNGTSYRANG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 35/139 (25%)
leucine-rich repeat 22..43 CDD:275380 1/3 (33%)
LRR_4 46..81 CDD:289563 9/37 (24%)
leucine-rich repeat 46..65 CDD:275378 3/21 (14%)
leucine-rich repeat 66..89 CDD:275378 10/23 (43%)
leucine-rich repeat 90..114 CDD:275378 7/23 (30%)
AT3G50690NP_190638.1 LRR_4 48..83 CDD:289563 8/34 (24%)
leucine-rich repeat 50..71 CDD:275380 3/20 (15%)
LRR_8 71..125 CDD:290566 19/54 (35%)
LRR_4 71..115 CDD:289563 15/43 (35%)
leucine-rich repeat 72..96 CDD:275380 10/23 (43%)
leucine-rich repeat 97..120 CDD:275380 7/23 (30%)
LRR_4 100..136 CDD:289563 12/36 (33%)
leucine-rich repeat 121..147 CDD:275380 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.