DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrrc9

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017951824.1 Gene:lrrc9 / 780204 XenbaseID:XB-GENE-1011352 Length:1514 Species:Xenopus tropicalis


Alignment Length:289 Identity:72/289 - (24%)
Similarity:112/289 - (38%) Gaps:82/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QSMQYINPCRERELDLRGYKIPQI-ENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNN 74
            :::|::     |||.|...:|..| |...|.|:...:::|.:|.||.|:|||.|.:|:.||:.:|
 Frog  1253 ENLQFL-----RELVLDHNRIKAIAETSFAKLNSLVSLNLEENRLRDLNNLPPLLKLRKLLIGSN 1312

  Fly    75 RILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLI------NPVSTKPNYRE 133
            :|                        ||:|::|      |||.|..|:      ||:|.||..|.
 Frog  1313 KI------------------------QEISEIE------KLEVIPALVELSISGNPISRKPFLRN 1347

  Fly   134 YMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEI----SRKSKMSAAAAIAAEAGN-- 192
            .:..:...|::||...|..:||..|:.:|..:|...|...:    :..|.|..:..:.....|  
 Frog  1348 LLVVRLQNLQILDGILITAEDRARAEMYFMEQQSLTVPNAVMDLGNPVSTMIVSKPLPLRVTNFP 1412

  Fly   193 --GKGRGSEGGRL----------------------------ANPQDMQRIREAIKRASSLAEVER 227
              |....|.|..|                            .|||:.|.|.....|..:......
 Frog  1413 LAGGAHHSLGADLHFNNGHEDIFQNEANKYKKLKNYTVGVGHNPQNTQDIALRQLRGGTHFPASY 1477

  Fly   228 LSQILQSGQLPDKFQHEMEAVAQNGAGHN 256
            |:|  ||||...:.:|...  .:|...||
 Frog  1478 LTQ--QSGQARSQQKHPFN--QENEGRHN 1502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 49/174 (28%)
leucine-rich repeat 22..43 CDD:275380 9/21 (43%)
LRR_4 46..81 CDD:289563 14/34 (41%)
leucine-rich repeat 46..65 CDD:275378 9/18 (50%)
leucine-rich repeat 66..89 CDD:275378 5/22 (23%)
leucine-rich repeat 90..114 CDD:275378 4/23 (17%)
lrrc9XP_017951824.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1269
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.