| Sequence 1: | NP_610315.1 | Gene: | U2A / 35713 | FlyBaseID: | FBgn0033210 | Length: | 265 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001348027.1 | Gene: | Lrrc72 / 71156 | MGIID: | 1920830 | Length: | 288 | Species: | Mus musculus |
| Alignment Length: | 204 | Identity: | 57/204 - (27%) |
|---|---|---|---|
| Similarity: | 93/204 - (45%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 SMQYINPCR------------------ERELDLRGYK--IPQIENLGATLDQFDTIDLSD-NDLR 55
Fly 56 -------KLDNLPHLPRLKC---LLLNNNRILRISEGLEEAVPNLGSIILTGNNLQEL-SDLEPL 109
Fly 110 VGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEI 174
Fly 175 SRKSKMSAA 183 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| U2A | NP_610315.1 | LRR_9 | 1..175 | CDD:258718 | 56/194 (29%) |
| leucine-rich repeat | 22..43 | CDD:275380 | 5/22 (23%) | ||
| LRR_4 | 46..81 | CDD:289563 | 18/45 (40%) | ||
| leucine-rich repeat | 46..65 | CDD:275378 | 9/26 (35%) | ||
| leucine-rich repeat | 66..89 | CDD:275378 | 11/25 (44%) | ||
| leucine-rich repeat | 90..114 | CDD:275378 | 6/24 (25%) | ||
| Lrrc72 | NP_001348027.1 | LRR | <16..>128 | CDD:227223 | 32/113 (28%) |
| leucine-rich repeat | 50..69 | CDD:275378 | 5/18 (28%) | ||
| leucine-rich repeat | 70..91 | CDD:275378 | 6/20 (30%) | ||
| LRR_9 | <79..191 | CDD:373143 | 39/113 (35%) | ||
| leucine-rich repeat | 92..113 | CDD:275378 | 10/22 (45%) | ||
| leucine-rich repeat | 114..139 | CDD:275378 | 6/24 (25%) | ||
| leucine-rich repeat | 140..151 | CDD:275378 | 4/10 (40%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1644 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1447031at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.820 | |||||