Sequence 1: | NP_610315.1 | Gene: | U2A / 35713 | FlyBaseID: | FBgn0033210 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018537.1 | Gene: | lrmda / 553730 | ZFINID: | ZDB-GENE-050522-285 | Length: | 234 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 59/214 - (27%) |
---|---|---|---|
Similarity: | 87/214 - (40%) | Gaps: | 46/214 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 RELDLRGYKIPQIENLGATLDQFDTI----DLSDNDLRKLDNLPHLPRLKCLLLNNNRILRIS-- 80
Fly 81 -EGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRL 144
Fly 145 LDFRKIKQKDRQAAQ------EFFRTKQGKDVLKEISRKSKMSAAAAI---AAEAGNGK------ 194
Fly 195 -----GRGSEGGR-LANPQ 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
U2A | NP_610315.1 | LRR_9 | 1..175 | CDD:258718 | 48/165 (29%) |
leucine-rich repeat | 22..43 | CDD:275380 | 6/20 (30%) | ||
LRR_4 | 46..81 | CDD:289563 | 16/41 (39%) | ||
leucine-rich repeat | 46..65 | CDD:275378 | 8/22 (36%) | ||
leucine-rich repeat | 66..89 | CDD:275378 | 9/25 (36%) | ||
leucine-rich repeat | 90..114 | CDD:275378 | 6/23 (26%) | ||
lrmda | NP_001018537.1 | leucine-rich repeat | 38..58 | CDD:275378 | 6/20 (30%) |
LRR_9 | <40..164 | CDD:317038 | 43/141 (30%) | ||
leucine-rich repeat | 59..80 | CDD:275378 | 8/24 (33%) | ||
leucine-rich repeat | 81..107 | CDD:275378 | 9/25 (36%) | ||
leucine-rich repeat | 108..146 | CDD:275378 | 11/50 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1644 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |