DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrmda

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001018537.1 Gene:lrmda / 553730 ZFINID:ZDB-GENE-050522-285 Length:234 Species:Danio rerio


Alignment Length:214 Identity:59/214 - (27%)
Similarity:87/214 - (40%) Gaps:46/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RELDLRGYKIPQIENLGATLDQFDTI----DLSDNDLRKLDNLPHLPRLKCLLLNNNRILRIS-- 80
            |.|||...::..:..|.| ..|.:.:    :|..||||    ||.||||..|.||.|::..|.  
Zfish    38 RRLDLSFNQLRSLTGLKA-FSQLEELIVDNNLLGNDLR----LPRLPRLHTLTLNKNQLTDIEAL 97

  Fly    81 -EGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRL 144
             |.|.|..|.|..:.|.||.    :....||...|.|         .....||.::.:|...|:.
Zfish    98 LEHLVEVTPALEYLSLLGNE----ACPNQLVSMDKDE---------DDYQRYRYFVLHKLTNLKF 149

  Fly   145 LDFRKIKQKDRQAAQ------EFFRTKQGKDVLKEISRKSKMSAAAAI---AAEAGNGK------ 194
            ||.|::.|.:|..||      :..:.|..:|...:...:|..:....:   :.:|.|.|      
Zfish   150 LDTRRVTQWERSEAQARGAFMKVVKPKNDQDTASDTRSESIATPYTPLPRGSRDARNHKGVFTKC 214

  Fly   195 -----GRGSEGGR-LANPQ 207
                 |:.|||.| :.|.|
Zfish   215 RYVYYGKHSEGNRFIRNDQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 48/165 (29%)
leucine-rich repeat 22..43 CDD:275380 6/20 (30%)
LRR_4 46..81 CDD:289563 16/41 (39%)
leucine-rich repeat 46..65 CDD:275378 8/22 (36%)
leucine-rich repeat 66..89 CDD:275378 9/25 (36%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
lrmdaNP_001018537.1 leucine-rich repeat 38..58 CDD:275378 6/20 (30%)
LRR_9 <40..164 CDD:317038 43/141 (30%)
leucine-rich repeat 59..80 CDD:275378 8/24 (33%)
leucine-rich repeat 81..107 CDD:275378 9/25 (36%)
leucine-rich repeat 108..146 CDD:275378 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.