DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrtomt

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_012812100.1 Gene:lrtomt / 394652 XenbaseID:XB-GENE-6257736 Length:211 Species:Xenopus tropicalis


Alignment Length:173 Identity:45/173 - (26%)
Similarity:80/173 - (46%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLL 71
            :|::|:::..|   ....||:|:. ...|.|.:...|...||||.|||..:|::  ||:.:    
 Frog    68 KLLSQALRLNN---NTLTDLKGFG-ETAEKLLSDPPQLRWIDLSFNDLSTIDSV--LPKYR---- 122

  Fly    72 NNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMA 136
                             ||..:.|..|::::||.::.|.....|:::.|..||:..:..||.|:.
 Frog   123 -----------------NLSVLNLHSNSIRQLSQVDKLAALPNLKSLTLHGNPIEGERGYRCYIL 170

  Fly   137 YKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSK 179
            ...|||:.|||..:.::||..|          ||.:.::.|.:
 Frog   171 SVLPQLKTLDFSAVTKQDRVTA----------DVWRRMNMKPR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 44/167 (26%)
leucine-rich repeat 22..43 CDD:275380 5/20 (25%)
LRR_4 46..81 CDD:289563 10/34 (29%)
leucine-rich repeat 46..65 CDD:275378 9/18 (50%)
leucine-rich repeat 66..89 CDD:275378 0/22 (0%)
leucine-rich repeat 90..114 CDD:275378 6/23 (26%)
lrtomtXP_012812100.1 LRR_RI <72..153 CDD:238064 26/107 (24%)
leucine-rich repeat 72..100 CDD:275378 7/31 (23%)
LRR_8 99..159 CDD:290566 21/82 (26%)
leucine-rich repeat 101..123 CDD:275378 10/44 (23%)
leucine-rich repeat 124..148 CDD:275378 6/23 (26%)
leucine-rich repeat 149..175 CDD:275378 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.