DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and CG31274

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732186.1 Gene:CG31274 / 318655 FlyBaseID:FBgn0051274 Length:280 Species:Drosophila melanogaster


Alignment Length:198 Identity:47/198 - (23%)
Similarity:64/198 - (32%) Gaps:80/198 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IDLSDNDLRKL----------------------DNLPHLPRLKCLLLNNNRILRISE---GLEEA 86
            :|||.||.|.|                      :..|:||.|:.|.:||..|..|::   .:|..
  Fly   114 LDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIHRIERH 178

  Fly    87 VPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIK 151
            .|.|..:...||           .|          |..|......|||:....|||:.||.   .
  Fly   179 CPALDQLSCMGN-----------PG----------IRTVFGGQGPREYILQVLPQLKYLDG---L 219

  Fly   152 QKDRQAAQEFFRTKQG--------------------KDVLK-EISRKSKMSAAAAIAAEAGNGKG 195
            ...|.||.....:.||                    ||::: :.||||          .:|...|
  Fly   220 PTSRNAAYATLSSSQGQGPDSTSNSEKPPLASAFTFKDIIRPKYSRKS----------HSGRMFG 274

  Fly   196 RGS 198
            .||
  Fly   275 NGS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 39/173 (23%)
leucine-rich repeat 22..43 CDD:275380
LRR_4 46..81 CDD:289563 16/55 (29%)
leucine-rich repeat 46..65 CDD:275378 9/39 (23%)
leucine-rich repeat 66..89 CDD:275378 7/25 (28%)
leucine-rich repeat 90..114 CDD:275378 4/23 (17%)
CG31274NP_732186.1 leucine-rich repeat 111..132 CDD:275378 7/17 (41%)
leucine-rich repeat 133..154 CDD:275378 2/20 (10%)
leucine-rich repeat 155..181 CDD:275378 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.