DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and Anp32a

DIOPT Version :10

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_037035.2 Gene:Anp32a / 25379 RGDID:11508551 Length:247 Species:Rattus norvegicus


Alignment Length:142 Identity:44/142 - (30%)
Similarity:70/142 - (49%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCL 69
            ||..:.:.:  ::.||..|        .:||.|....::.:.:...:..|..:.|||.|.:||.|
  Rat    15 TPSDVKELV--LDNCRSIE--------GKIEGLTDEFEELEFLSTINVGLTSISNLPKLNKLKKL 69

  Fly    70 LLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREY 134
            .|:.|||....|.|.|..|||..:.|:||.:::||.:|||.....|:::.|....|:....|||.
  Rat    70 ELSENRISGDLEVLAEKCPNLKHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNAYREN 134

  Fly   135 MAYKFPQLRLLD 146
            :....||:..||
  Rat   135 VFKLLPQVMYLD 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:405295 44/142 (31%)
leucine-rich repeat 22..43 CDD:275380 4/20 (20%)
leucine-rich repeat 46..65 CDD:275378 5/18 (28%)
leucine-rich repeat 66..89 CDD:275378 10/22 (45%)
leucine-rich repeat 90..114 CDD:275378 9/23 (39%)
Anp32aNP_037035.2 LRR_9 <65..146 CDD:405295 29/80 (36%)
LRR 3 65..87 10/21 (48%)
LRR 4 89..110 9/20 (45%)
leucine-rich repeat 90..113 CDD:275382 9/22 (41%)
leucine-rich repeat 115..141 CDD:275382 6/25 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..247
Necessary for tumor-suppressive function. /evidence=ECO:0000250 150..172
Interaction with E4F1. /evidence=ECO:0000250 165..247
LRR 1 18..41 6/32 (19%)
LRR 2 43..64 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.