DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and T19H12.2

DIOPT Version :10

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_504310.2 Gene:T19H12.2 / 178881 WormBaseID:WBGene00020588 Length:228 Species:Caenorhabditis elegans


Alignment Length:193 Identity:42/193 - (21%)
Similarity:74/193 - (38%) Gaps:45/193 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LDQFDTIDLSDNDLRKLDNLPHL----PRLKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQ 101
            |...:.:|||||:|....:...|    |.:|.:.|:.||:...:....:.:|||..:.|:.|:..
 Worm    62 LPALNYLDLSDNELGDDASFDVLIKCAPEIKKITLSGNRLTLDNVRTLKMLPNLMELDLSNNSSL 126

  Fly   102 ELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQ 166
            .|.|                        :||..|....|.|::||...:   |.:..:|.|...:
 Worm   127 GLLD------------------------DYRVKMFEMIPSLKILDGCDV---DGEEVEEEFAAGE 164

  Fly   167 GKDVLKE-----------ISRKSKMSAAAA---IAAEAGNGKGRGSEGGRLANPQDMQRIREA 215
            |.:...|           ...||:.|....   :..|||:.:.||::....|:..:.:..:.|
 Worm   165 GAEDSDEGDSDEDGPGLSYLNKSQFSDDETDDYVVPEAGDAETRGAKRAASADCDEPEAKKSA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:405295 32/148 (22%)
leucine-rich repeat 22..43 CDD:275380 1/1 (100%)
leucine-rich repeat 46..65 CDD:275378 7/22 (32%)
leucine-rich repeat 66..89 CDD:275378 4/22 (18%)
leucine-rich repeat 90..114 CDD:275378 5/23 (22%)
T19H12.2NP_504310.2 leucine-rich repeat 22..42 CDD:275378
PPP1R42 <43..151 CDD:455733 27/112 (24%)
leucine-rich repeat 43..64 CDD:275378 1/1 (100%)
leucine-rich repeat 65..90 CDD:275378 7/24 (29%)
leucine-rich repeat 91..114 CDD:275378 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.