DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrrc72

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021322143.1 Gene:lrrc72 / 101883707 -ID:- Length:120 Species:Danio rerio


Alignment Length:62 Identity:19/62 - (30%)
Similarity:37/62 - (59%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEIS 175
            :|.|:.|.:||.:..|.||.|:.:....::.||.::::|.:|:.|.:.|..::.| ||..|:
Zfish     3 ELHTLSLYLNPFTEDPEYRLYVLHHLQSVQFLDTKEVQQVERRRALKLFNAERQK-VLDTIA 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 18/60 (30%)
leucine-rich repeat 22..43 CDD:275380
LRR_4 46..81 CDD:289563
leucine-rich repeat 46..65 CDD:275378
leucine-rich repeat 66..89 CDD:275378
leucine-rich repeat 90..114 CDD:275378 19/62 (31%)
lrrc72XP_021322143.1 LRR_9 <1..59 CDD:317038 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.