powered by:
Protein Alignment U2A and lrrc72
DIOPT Version :9
Sequence 1: | NP_610315.1 |
Gene: | U2A / 35713 |
FlyBaseID: | FBgn0033210 |
Length: | 265 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021322143.1 |
Gene: | lrrc72 / 101883707 |
-ID: | - |
Length: | 120 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 19/62 - (30%) |
Similarity: | 37/62 - (59%) |
Gaps: | 1/62 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 KLETICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEIS 175
:|.|:.|.:||.:..|.||.|:.:....::.||.::::|.:|:.|.:.|..::.| ||..|:
Zfish 3 ELHTLSLYLNPFTEDPEYRLYVLHHLQSVQFLDTKEVQQVERRRALKLFNAERQK-VLDTIA 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1447031at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.