DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and LRRC72

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011513359.1 Gene:LRRC72 / 100506049 HGNCID:42972 Length:318 Species:Homo sapiens


Alignment Length:132 Identity:41/132 - (31%)
Similarity:68/132 - (51%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KLDNLPHLPRLKC---LLLNNNRILRISEGLEEAVPNLGSIILTGNNLQEL-SDLEPLVGFTKLE 116
            ||..:..|.|..|   |.||||.|..| ||| ..:|:|..::|..|.|..: :.::.|.|...|:
Human    78 KLHGITFLTRNYCLTELYLNNNAIFEI-EGL-HYLPSLHILLLHHNELTNIDATVKELKGMLNLK 140

  Fly   117 TICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKMS 181
            .:.|..||:.....||.|:.|..|.:.|||..::.:|:|::....|..|:. .:::.|:...|:.
Human   141 ILSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERRSMITIFNHKKA-HIVQSIAFGGKVD 204

  Fly   182 AA 183
            |:
Human   205 AS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 38/122 (31%)
leucine-rich repeat 22..43 CDD:275380
LRR_4 46..81 CDD:289563 12/27 (44%)
leucine-rich repeat 46..65 CDD:275378 3/8 (38%)
leucine-rich repeat 66..89 CDD:275378 11/25 (44%)
leucine-rich repeat 90..114 CDD:275378 6/24 (25%)
LRRC72XP_011513359.1 leucine-rich repeat 49..68 CDD:275378
LRR_4 67..107 CDD:289563 13/29 (45%)
leucine-rich repeat 69..87 CDD:275378 3/8 (38%)
LRR_8 91..149 CDD:290566 20/59 (34%)
LRR_4 91..128 CDD:289563 15/38 (39%)
leucine-rich repeat 91..112 CDD:275378 10/22 (45%)
leucine-rich repeat 113..138 CDD:275378 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.