DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and LRRC72

DIOPT Version :10

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011513359.1 Gene:LRRC72 / 100506049 HGNCID:42972 Length:318 Species:Homo sapiens


Alignment Length:132 Identity:41/132 - (31%)
Similarity:68/132 - (51%) Gaps:7/132 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KLDNLPHLPRLKC---LLLNNNRILRISEGLEEAVPNLGSIILTGNNLQEL-SDLEPLVGFTKLE 116
            ||..:..|.|..|   |.||||.|..| ||| ..:|:|..::|..|.|..: :.::.|.|...|:
Human    78 KLHGITFLTRNYCLTELYLNNNAIFEI-EGL-HYLPSLHILLLHHNELTNIDATVKELKGMLNLK 140

  Fly   117 TICLLINPVSTKPNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKMS 181
            .:.|..||:.....||.|:.|..|.:.|||..::.:|:|::....|..|:. .:::.|:...|:.
Human   141 ILSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKERRSMITIFNHKKA-HIVQSIAFGGKVD 204

  Fly   182 AA 183
            |:
Human   205 AS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:405295 38/122 (31%)
leucine-rich repeat 22..43 CDD:275380
leucine-rich repeat 46..65 CDD:275378 3/8 (38%)
leucine-rich repeat 66..89 CDD:275378 11/25 (44%)
leucine-rich repeat 90..114 CDD:275378 6/24 (25%)
LRRC72XP_011513359.1 leucine-rich repeat 49..68 CDD:275378
PPP1R42 50..183 CDD:455733 36/106 (34%)
leucine-rich repeat 69..87 CDD:275378 3/8 (38%)
leucine-rich repeat 91..112 CDD:275378 10/22 (45%)
leucine-rich repeat 113..138 CDD:275378 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.