DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and lrrc72

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_002933350.2 Gene:lrrc72 / 100495842 XenbaseID:XB-GENE-22068673 Length:260 Species:Xenopus tropicalis


Alignment Length:206 Identity:50/206 - (24%)
Similarity:88/206 - (42%) Gaps:42/206 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPRLKCLLLNNNRILRIS----- 80
            |.:|...|||    .||...     .:.|....|:::.:|.....||.|.||:|:|.||:     
 Frog     7 EEQLRKCGYK----RNLDVA-----ELYLGRKGLKEVTDLSRFRMLKFLWLNHNKITRITCLSNN 62

  Fly    81 ----------------EGLEEAVPNLGSIILTGNNLQEL-SDLEPLVGFTKLETICLLINPVSTK 128
                            .|..:.:.:|.:::|..|.|..| :....|.|.|.|:.:.|..||::.:
 Frog    63 WQLSELYLNNNEICDITGCLKHLTSLHTLLLNNNRLANLQATATELKGMTNLQILSLFNNPLAQE 127

  Fly   129 PNYREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQ---------GK--DVLKEISRKSKMSA 182
            .:||.|:.:..|.::.||.:|:.||:|..|.:.|..::         |:  |.:......||.|.
 Frog   128 SSYRPYIIHYIPSVQRLDRQKVVQKERDNAFKIFNPERTAVIQSLGFGRRTDSVLATKSTSKSSL 192

  Fly   183 AAAIAAEAGNG 193
            ..::.:...:|
 Frog   193 RKSVPSSGNDG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 46/186 (25%)
leucine-rich repeat 22..43 CDD:275380 6/20 (30%)
LRR_4 46..81 CDD:289563 12/55 (22%)
leucine-rich repeat 46..65 CDD:275378 3/18 (17%)
leucine-rich repeat 66..89 CDD:275378 10/43 (23%)
leucine-rich repeat 90..114 CDD:275378 7/24 (29%)
lrrc72XP_002933350.2 leucine-rich repeat 23..42 CDD:275378 3/18 (17%)
LRR_9 <31..169 CDD:373143 36/137 (26%)
leucine-rich repeat 43..64 CDD:275378 9/20 (45%)
leucine-rich repeat 65..113 CDD:275378 8/47 (17%)
leucine-rich repeat 114..140 CDD:275378 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.