DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and snrpa1

DIOPT Version :9

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_002939312.2 Gene:snrpa1 / 100486145 XenbaseID:XB-GENE-1007226 Length:255 Species:Xenopus tropicalis


Alignment Length:264 Identity:136/264 - (51%)
Similarity:175/264 - (66%) Gaps:20/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTPELINQSMQYINPCRERELDLRGYKIPQIENLGATLDQFDTIDLSDNDLRKLDNLPHLPR 65
            |||||.:||.|:.||.|..|:|||||||||||.|||||||||||||||.|||::||||..|.|.|
 Frog     1 MVKLTADLIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDTIDCSDNEIRKLDGFPLLKR 65

  Fly    66 LKCLLLNNNRILRISEGLEEAVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPN 130
            ||.||||||||.||.||:|.|:|||..:|||.|::.||.||:.|.....|..|.||.|||:.|.:
 Frog    66 LKTLLLNNNRICRIGEGIEHALPNLTELILTNNSITELGDLDNLSPCKHLTYISLLRNPVTNKRH 130

  Fly   131 YREYMAYKFPQLRLLDFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSKMSAAAAIAAEAGNGKG 195
            ||.|:.||.||:|:|||.|:||.:|:.|...|:.|:|..:.|:|:::||....         |.|
 Frog   131 YRMYVIYKIPQVRVLDFEKVKQSEREEAANMFKGKRGAQLAKDIAKRSKTFVP---------GAG 186

  Fly   196 RGSEGGRLA-NPQDMQRIREAIKRASSLAEVERLSQILQSGQLPDK---------FQHEM-EAVA 249
            ..:|..:.. :|.|::.|:.||..|::|||||||:.:|||||:|.|         .:.|| |.|.
 Frog   187 LPTEKKKAGPSPGDVEAIKNAIANATTLAEVERLNGLLQSGQIPGKDHVLATSEEAEEEMDEDVV 251

  Fly   250 QNGA 253
            .||:
 Frog   252 TNGS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:258718 104/173 (60%)
leucine-rich repeat 22..43 CDD:275380 19/20 (95%)
LRR_4 46..81 CDD:289563 25/34 (74%)
leucine-rich repeat 46..65 CDD:275378 12/18 (67%)
leucine-rich repeat 66..89 CDD:275378 16/22 (73%)
leucine-rich repeat 90..114 CDD:275378 10/23 (43%)
snrpa1XP_002939312.2 LRR_9 1..175 CDD:373143 104/173 (60%)
leucine-rich repeat 46..65 CDD:275380 12/18 (67%)
leucine-rich repeat 90..114 CDD:275380 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2325
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54461
OrthoDB 1 1.010 - - D1447031at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10552
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.