DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment U2A and LOC100331330

DIOPT Version :10

Sequence 1:NP_610315.1 Gene:U2A / 35713 FlyBaseID:FBgn0033210 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_068078894.1 Gene:LOC100331330 / 100331330 -ID:- Length:202 Species:Danio rerio


Alignment Length:164 Identity:37/164 - (22%)
Similarity:69/164 - (42%) Gaps:45/164 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DQFDTIDLSDN----------DLRKLDNL-------------PHLPRLKCLLLNNNRILRISEGL 83
            |..:.:|||.|          .|.||..|             |.:|.|..|.:|.|:|..:...:
Zfish    54 DSLEVLDLSYNLLEENPALLGGLEKLSTLILDCNNYSAHVKFPFMPSLTTLWINKNKISNLPIIV 118

  Fly    84 EE---AVPNLGSIILTGNNLQELSDLEPLVGFTKLETICLLINPVSTKPNYREYMAYKFPQLRLL 145
            ||   ..||:..:.:..|        |....:....::...|       :||:|:..:...|.:|
Zfish   119 EEICCKFPNIKILSMMNN--------EAAPSYFNGGSLTQYI-------DYRQYVISQILGLEVL 168

  Fly   146 DFRKIKQKDRQAAQEFFRTKQGKDVLKEISRKSK 179
            |..::::|:|:.|::.:|.::    ::|.||:.|
Zfish   169 DDTEVQEKEREQARKTYRLQR----IREGSRRRK 198

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
U2ANP_610315.1 LRR_9 1..175 CDD:405295 34/158 (22%)