DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL52 and Mrpl52

DIOPT Version :9

Sequence 1:NP_610313.1 Gene:mRpL52 / 35711 FlyBaseID:FBgn0033208 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_081127.1 Gene:Mrpl52 / 68836 MGIID:1916086 Length:121 Species:Mus musculus


Alignment Length:113 Identity:41/113 - (36%)
Similarity:62/113 - (54%) Gaps:11/113 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLTNLPDYTYLDGRPTPLGANQKRRLIKQQEI 79
            |:.:|.......||..| ||..:||..||:.:||||.|||:::.||||.|....|.||..:::::
Mouse     9 SSVRRLHCSVVARAGGQ-WRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRRKAQREKL 72

  Fly    80 ATRIVELSGELEFA----KQRHERLKANAESEKQRLIRSKLKPKGHFL 123
            |.|:|.|:.|::..    |.|.::|:...:.|..      |||||..|
Mouse    73 ARRVVLLTQEMDAGIQAWKLRQQKLQEERKKEHD------LKPKGTLL 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL52NP_610313.1 None
Mrpl52NP_081127.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..121 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831197
Domainoid 1 1.000 69 1.000 Domainoid score I9666
eggNOG 1 0.900 - - E1_2CW4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5309
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008414
OrthoInspector 1 1.000 - - oto92867
orthoMCL 1 0.900 - - OOG6_109481
Panther 1 1.100 - - LDO PTHR34090
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4740
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.