DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL52 and Mrpl52

DIOPT Version :9

Sequence 1:NP_610313.1 Gene:mRpL52 / 35711 FlyBaseID:FBgn0033208 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001101845.2 Gene:Mrpl52 / 361037 RGDID:1309297 Length:122 Species:Rattus norvegicus


Alignment Length:110 Identity:40/110 - (36%)
Similarity:62/110 - (56%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 STAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLTNLPDYTYLDGRPTPLGANQKRRLIKQQEI 79
            |...|.:..:|......:||..:||..||:.:||||.|||:::.||||.|....|.||..:::::
  Rat     9 SIGVRRLHSSAVARAGSQWRLQQGLAANPSGYGPLTELPDWSFADGRPAPPMKGQLRREAQREKL 73

  Fly    80 ATRIVELSGELEFA----KQRHERLKANAESEKQRLIRSKLKPKG 120
            |.|:|.|:.|::..    |.|.::|:   |..||   :..|||||
  Rat    74 ARRVVLLTQEMDAGLQAWKLRQQKLQ---EERKQ---KHDLKPKG 112



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334921
Domainoid 1 1.000 69 1.000 Domainoid score I9442
eggNOG 1 0.900 - - E1_2CW4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5224
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623574at2759
OrthoFinder 1 1.000 - - FOG0008414
OrthoInspector 1 1.000 - - oto96420
orthoMCL 1 0.900 - - OOG6_109481
Panther 1 1.100 - - LDO PTHR34090
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.