DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL52 and mRpL52

DIOPT Version :10

Sequence 1:NP_610313.1 Gene:mRpL52 / 35711 FlyBaseID:FBgn0033208 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_314355.5 Gene:mRpL52 / 1275127 VectorBaseID:AGAMI1_009117 Length:122 Species:Anopheles gambiae


Alignment Length:85 Identity:52/85 - (61%)
Similarity:68/85 - (80%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NPNAFGPLTNLPDYTYLDGRPTPLGANQKRRLIKQQEIATRIVELSGELEFAKQRHERLKANAES 106
            |||....||:||||||:|||.||.||||::|:|:|:|||.:||.||.|::||.:||:|..|.||.
Mosquito    37 NPNKSSLLTHLPDYTYMDGRVTPFGANQRKRIIQQREIAKQIVTLSKEMDFAVERHQRNMAEAEE 101

  Fly   107 EKQRLIRSKLKPKGHFLLKK 126
            .||:|:.:|||||||.||:|
Mosquito   102 TKQKLLAAKLKPKGHLLLQK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL52NP_610313.1 MRPL52 30..120 CDD:465836 46/77 (60%)
mRpL52XP_314355.5 None

Return to query results.
Submit another query.