DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL52 and mrpl52

DIOPT Version :9

Sequence 1:NP_610313.1 Gene:mRpL52 / 35711 FlyBaseID:FBgn0033208 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001314839.1 Gene:mrpl52 / 100007768 ZFINID:ZDB-GENE-110325-1 Length:127 Species:Danio rerio


Alignment Length:120 Identity:45/120 - (37%)
Similarity:69/120 - (57%) Gaps:4/120 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LASSATSTAQRSIALTAPRAIDQKWRAAKGLPENPNAFGPLTNLPDYTYLDGRPTPLGANQKRRL 73
            :.::.:..:.|:.:.|.......|||...|||...:.:||||:|||:::.||||.||...|.||.
Zfish     8 VGAAVSRQSVRTFSSTCVTHAGIKWRLENGLPRGGSEYGPLTDLPDWSFADGRPAPLLKGQIRRQ 72

  Fly    74 IKQQEIATRIVELSGEL-EFAKQRHERLKANAESEKQRLIRS-KLKPKGHFLLKK 126
            .:::|.|.|.|.|:.|: |..||.||..||..:.|:.  ::| .|||||:...:|
Zfish    73 KQREEFARRAVYLNAEMDEGMKQWHESEKAKKQKEED--VKSLLLKPKGNLFKQK 125



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574160
Domainoid 1 1.000 74 1.000 Domainoid score I9167
eggNOG 1 0.900 - - E1_2CW4K
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5259
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623574at2759
OrthoFinder 1 1.000 - - FOG0008414
OrthoInspector 1 1.000 - - oto39803
orthoMCL 1 0.900 - - OOG6_109481
Panther 1 1.100 - - LDO PTHR34090
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4740
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.