DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and YKL107W

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_012815.1 Gene:YKL107W / 853753 SGDID:S000001590 Length:309 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:61/280 - (21%)
Similarity:114/280 - (40%) Gaps:34/280 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKF 112
            :.|...|:|:..:.|:|:|...|.:..:..      |.:.:|:..|   |.: .|||.:...::.
Yeast    28 IIGGTGGLGRAISRELAQRNARVTVVGQTF------RDEDLKDKIN---FVK-ADLSLVSECKRI 82

  Fly   113 VDGFKKEQPKLHVLINNAGVMRC-PKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRI-- 174
            ....:....:|..||...|:... .:..|.:|.|..:.|:::..:::.:   ||.|....||.  
Yeast    83 SHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFH---DVAKRLGISRTKK 144

  Fly   175 -----VVVSSLAHARGSI-NVADLNS-EKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNAL 232
                 |.::... ..|.: :..|||| ||.|.....:..:..||.....:...|.  :.:....|
Yeast   145 DDLPKVFIAGFP-GNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRY--TNIDTFGL 206

  Fly   233 HPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSD--- 294
            :||::.|.:..|.....|.|.:.....:.| ..::.::.|:|.......|.:::.||..||:   
Yeast   207 NPGLIKTNIRNNLLGSDTYLSRITEWIISW-TCQSAETYAKTICTLIASPAIESRSGTMFSNKGD 270

  Fly   295 -CKPKPVASGALDDKVAKFL 313
             ..|.|   |...|.|.||:
Yeast   271 AILPSP---GLTKDVVEKFM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 61/280 (22%)
NADB_Rossmann 43..317 CDD:304358 61/280 (22%)
YKL107WNP_012815.1 NADB_Rossmann 26..285 CDD:419666 59/276 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.