DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and AT1G64590

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:305 Identity:120/305 - (39%)
Similarity:172/305 - (56%) Gaps:23/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GGKFTKD-----TDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKET 91
            |.:.|.|     :|......|:|||.:|||.|||..:|:||..:.|..|.:...|:.:..|:.|.
plant    18 GSRSTADHVTCNSDLRSLTAIITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSEF 82

  Fly    92 NNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHF 156
            .:..|....||||||.|:|:|||.|:.....|::||||||.......|::||.|:....|::|||
plant    83 PDAEIIVMHLDLSSLTSVRRFVDDFESLNLPLNILINNAGKYAHKHALSEDGVEMTFATNYLGHF 147

  Fly   157 LLTNLLLDVLKNSA-----PSRIVVVSSLAHARGSIN----VADLN-SEKSYDEGLAYSQSKLAN 211
            |||.|||..:..:|     ..|||.|:|:.|:..|.:    :||:: :.::||...||:.|||||
plant   148 LLTKLLLKKMIETAAQTGVQGRIVNVTSVVHSWFSGDMLQYLADISRNNRNYDATRAYALSKLAN 212

  Fly   212 VLFTRELAKRLE--GSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQT 274
            ||.|.||::.|.  .:.||.|.:|||:|.|.|.|:.....|:|| |||..   .|||:....|.|
plant   213 VLHTVELSRLLHKMDANVTANCVHPGIVKTRLTRDREGVVTDLV-FFLTS---KLLKSVPQAAAT 273

  Fly   275 SIYAALDPELKNISGLYFSDC-KPKPVASGALDDKVAKFLWAESE 318
            :.|.|..|.|:|:.|.||||| :.:...||:.:.| |:.||..|:
plant   274 TCYVATSPRLRNVCGKYFSDCNEARSSKSGSCNLK-AQRLWTASD 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 117/292 (40%)
NADB_Rossmann 43..317 CDD:304358 115/286 (40%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 113/281 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.