DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and AT5G53090

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_200121.4 Gene:AT5G53090 / 835389 AraportID:AT5G53090 Length:375 Species:Arabidopsis thaliana


Alignment Length:311 Identity:100/311 - (32%)
Similarity:167/311 - (53%) Gaps:42/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQ--------NIFSRELDL 103
            ||||:.:|||:|||.::|..|..|.:|.|:    .||..::|::...:        |:.:.||||
plant    60 IVTGSTSGIGRETARQLAEAGARVVMAVRN----TKAAHELIQQWQKEWSGKGIPLNLEAMELDL 120

  Fly   104 SSLDSIRKFVDGFKKEQPKLHVLINNAGV--MRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVL 166
            .||||:..|.:.:......|||||||||:  |...:..:|||||..:.|||:...||:.|||..|
plant   121 LSLDSVVGFCNLWNARLSPLHVLINNAGIFSMGEEQKFSKDGYEQHMQVNHLAPALLSLLLLPSL 185

  Fly   167 KNSAPSRIVVVSSLAHARGSINVADLN---SEKSYDEGLAYSQSKLANVLFTRELAKRLE-GSGV 227
            ...:||||:.|:|:.|..|.::..|:|   .::.:...:.||.||||.|:|:..|.|||. .:.:
plant   186 IRGSPSRIINVNSVMHYVGFVDPDDMNVVSGKRKFTSLVGYSGSKLAQVMFSNVLLKRLPLETRI 250

  Fly   228 TVNALHPGVVDTELARN---WAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPEL----- 284
            :|..|.||:|.|.:||:   :...|..|:.:|        :.:|:.|:::::::|.|.::     
plant   251 SVVCLSPGIVLTNVARDLPRYVQVQYALIPYF--------IFSPQEGSRSTLFSATDAQIPEHCE 307

  Fly   285 ------KNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTG--LDKLE 327
                  |.:......:||....:..|.:.:.|:.:|.::.|..|  ||.:|
plant   308 KLKTEDKPVCTFISQNCKHTKPSEEAHNVETAERVWEKTIKLIGLPLDAVE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 96/302 (32%)
NADB_Rossmann 43..317 CDD:304358 95/297 (32%)
AT5G53090NP_200121.4 NADB_Rossmann 60..343 CDD:419666 94/294 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.