DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Tic32-IVa

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_849428.1 Gene:Tic32-IVa / 828442 AraportID:AT4G23430 Length:322 Species:Arabidopsis thaliana


Alignment Length:315 Identity:125/315 - (39%)
Similarity:174/315 - (55%) Gaps:34/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRE 100
            |...|.||...|||||::|||.|||..::.||..|.:|.|:.:...|.::||:|:.....:...|
plant    22 THGVDGTGLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQVPGAKLDVME 86

  Fly   101 LDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDV 165
            |||||:.|:|||...:|.....|::||||||:|.||..|:||..|||...||:||||||.||||.
plant    87 LDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDT 151

  Fly   166 LKNSA-----PSRIVVVSSLAHARG---SINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRL 222
            :|:::     ..|||.:||.||...   .:....:|.:.||....||.||||.|||...||.|:|
plant   152 MKSTSRESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHANELTKQL 216

  Fly   223 --EGSGVTVNALHPGVVDTELARNWAFFQTNL-------VKFFLKPMIWPLLKTPKSGAQTSIYA 278
              :|..:|.|:||||.:.|.|.|   :|...|       .|:        :||:...||.|:.|.
plant   217 KEDGVNITANSLHPGAIMTNLGR---YFNPYLAVAVGAVAKY--------ILKSVPQGAATTCYV 270

  Fly   279 ALDPELKNISGLYFSD---CKPKPVASGALDDKVAKFLWAESEKWTGLDKLEANN 330
            ||:|::..:||.||.|   .||.|:..   |.::||.:|..|.|.|.....|:::
plant   271 ALNPQVAGVSGEYFQDSNIAKPLPLVK---DTELAKKVWDFSTKLTDSQSGESSS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 122/301 (41%)
NADB_Rossmann 43..317 CDD:304358 118/293 (40%)
Tic32-IVaNP_849428.1 retinol-DH_like_SDR_c_like 29..306 CDD:212492 117/290 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm1091
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.