DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Rdh12

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_084293.1 Gene:Rdh12 / 77974 MGIID:1925224 Length:316 Species:Mus musculus


Alignment Length:302 Identity:151/302 - (50%)
Similarity:198/302 - (65%) Gaps:14/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKE 90
            ::::..||..|.:....|||.::||||||||||||.|:||||..||:||||:.:.|.|..:|..:
Mouse    22 IRKFFAGGVCTTNVQIPGKVVVITGANTGIGKETARELARRGARVYIACRDVLKGESAASEIRAD 86

  Fly    91 TNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGH 155
            |.|..:..|:||||...|||.|.:.|..|:.|||:||||||||.||.:.|.||:|...||||:||
Mouse    87 TKNSQVLVRKLDLSDTKSIRAFAERFLAEEKKLHILINNAGVMMCPYSKTTDGFETHFGVNHLGH 151

  Fly   156 FLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAK 220
            ||||.|||:.||.|||:|:|.:||:||..|.|...||..:|.|....||..|||||:||||||||
Mouse   152 FLLTYLLLERLKESAPARVVNLSSIAHLIGKIRFHDLQGQKRYCSAFAYGHSKLANLLFTRELAK 216

  Fly   221 RLEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIW----PLLKTPKSGAQTSIYAALD 281
            ||:|:|||..|:|||||.:|:.||          .:|..::|    |..|:...|||||::.||.
Mouse   217 RLQGTGVTAYAVHPGVVLSEITRN----------SYLLCLLWRLFSPFFKSTSQGAQTSLHCALA 271

  Fly   282 PELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGL 323
            .:|:.:||.||||||...|:|.|.:.|.|:.||..|.:..|:
Mouse   272 EDLEPLSGKYFSDCKRMWVSSRARNKKTAERLWNVSCELLGI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 147/285 (52%)
NADB_Rossmann 43..317 CDD:304358 146/277 (53%)
Rdh12NP_084293.1 PRK06197 39..316 CDD:235737 148/285 (52%)
NADB_Rossmann 39..307 CDD:304358 146/277 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm8848
orthoMCL 1 0.900 - - OOG6_100091
Panther 1 1.100 - - O PTHR24320
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.820

Return to query results.
Submit another query.