DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Dhrs13

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_899109.2 Gene:Dhrs13 / 70451 MGIID:1917701 Length:376 Species:Mus musculus


Alignment Length:286 Identity:131/286 - (45%)
Similarity:186/286 - (65%) Gaps:13/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            |:..:|||||:||||.||||:||||..|.||||...|.|.|..|:.:|:.|..:....|||:||.
Mouse    36 GRTVVVTGANSGIGKMTALELARRGARVVLACRSRERGEAAAFDLRQESGNNEVIFMALDLASLA 100

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPS 172
            |::.|...|...:|:|.|||:|||:..|.:  |::.:.|.|.|||:|.||||:|||..|::.|||
Mouse   101 SVQAFATAFLSSEPRLDVLIHNAGISSCGR--TRETFNLLLRVNHVGPFLLTHLLLPRLRSCAPS 163

  Fly   173 RIVVVSSLAHARGSINVADLNSE-KSYDEGL-AYSQSKLANVLFTRELAKRLEGSGVTVNALHPG 235
            |:|:|||.||.||.::...|:.. ..:.:.| ||:.||||||||.||||.:|||:|||..|.|||
Mouse   164 RVVIVSSAAHRRGRLDFTRLDCPVVGWQQELRAYADSKLANVLFARELATQLEGTGVTCYAAHPG 228

  Fly   236 VVDTELARNWAFFQTNL---VKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKP 297
            .|::||      |..:|   ::..|:|:.|.:|:.|:.||||.:|.||...::.:||.||::|..
Mouse   229 PVNSEL------FLRHLPGWLRPILRPLAWLVLRAPQGGAQTPLYCALQEGIEPLSGRYFANCHV 287

  Fly   298 KPVASGALDDKVAKFLWAESEKWTGL 323
            :.|:..|.||:.|:.||..::|..||
Mouse   288 EEVSPAARDDQAAQRLWKATKKLAGL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 129/283 (46%)
NADB_Rossmann 43..317 CDD:304358 128/278 (46%)
Dhrs13NP_899109.2 PRK06197 31..312 CDD:235737 129/283 (46%)
retinol-DH_like_SDR_c_like 36..304 CDD:212492 126/275 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..376 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9393
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.