DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and dhrs12la

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:312 Identity:101/312 - (32%)
Similarity:168/312 - (53%) Gaps:35/312 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YFLK---EYMQGG------KFTK---DTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRD 76
            :|||   |:.:|.      .|.:   :|...|:.|::||||:||||..|:.||::||||::.||:
Zfish     9 WFLKGLTEFTKGAFLSASKNFVEKDLETSMAGRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRN 73

  Fly    77 MNRCEKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTK 141
            .::.|:||.:|:||:.|:.|:...||||....:.:||:.|||:...|:|||||||.|...:.:..
Zfish    74 KDKAEEARAEIVKESGNKEIYVHILDLSETKKVWEFVESFKKKYKTLNVLINNAGCMMTKREVNG 138

  Fly   142 DGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKS-YDEGLAYS 205
            :|.|.....|.:..|:....|:.:|:.|...|::.|||.......:...:|.|::. ||..:.|:
Zfish   139 EGLEKSFASNSLAVFIFIKSLIPLLEKSPDPRVITVSSGGMLVQKLRTGNLQSQRGRYDGTMVYA 203

  Fly   206 QSKLANVLFTRELAKRLEGSGVTVNALHPGVVDT-ELARNWAFFQTNLVKFFLKPMIWPLLKTPK 269
            |:|...|:.|.:.||  ....:..:.:|||.||| .:|.....|.:::.:         .|:|.:
Zfish   204 QNKRQQVVMTEQFAK--AHPSIHFSVMHPGWVDTPTIANAMPDFHSSMKE---------RLRTTE 257

  Fly   270 SGAQTSIYAAL-DPELKNISGLYFSDCK----PKPVA---SGALDDKVAKFL 313
            .||.|.::.|: :...||.||.::.|.|    ..|:|   |..|:|:  ||:
Zfish   258 QGADTVVWLAVSEAAAKNPSGRFYQDRKMVSAHLPLAWTHSSQLEDQ--KFM 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 94/284 (33%)
NADB_Rossmann 43..317 CDD:304358 94/281 (33%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 81/246 (33%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 88/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.