DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and RDH14

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_065956.1 Gene:RDH14 / 57665 HGNCID:19979 Length:336 Species:Homo sapiens


Alignment Length:300 Identity:149/300 - (49%)
Similarity:194/300 - (64%) Gaps:23/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQ------------- 94
            ||..::||||:|:|:.||.|:.|.|..|.:.|||..|.|:|...:.:|....             
Human    43 GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVG 107

  Fly    95 NIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLT 159
            .:..|||||:||.|:|.|.....:|:|:|.|||||||:.:||...|:||:|:|.||||:||||||
Human   108 ELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLT 172

  Fly   160 NLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEG 224
            ||||.:||:|||||||||||..:..|.||..|||||:||::...||:|||||:|||||||:||||
Human   173 NLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKLANILFTRELARRLEG 237

  Fly   225 SGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMI----WPLLKTPKSGAQTSIYAALDPELK 285
            :.||||.||||:|.|.|.|:..      :...:||:.    |...|||..|||||||.|..||::
Human   238 TNVTVNVLHPGIVRTNLGRHIH------IPLLVKPLFNLVSWAFFKTPVEGAQTSIYLASSPEVE 296

  Fly   286 NISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGLDK 325
            .:||.||.|||.:.:...|:|:.||:.||..||...||.|
Human   297 GVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGLLK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 146/295 (49%)
NADB_Rossmann 43..317 CDD:304358 144/290 (50%)
RDH14NP_065956.1 retinol-DH_like_SDR_c 43..328 CDD:212495 144/290 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8851
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.