DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and Rdh14

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:298 Identity:149/298 - (50%)
Similarity:196/298 - (65%) Gaps:22/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKE-----------TNNQNI 96
            ||..::||||:|:|:.||.|:.|.|..|.:.|||..|.|:|...:.:|           |:.| :
  Rat    44 GKTVLITGANSGLGRATAGELLRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQ-L 107

  Fly    97 FSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNL 161
            ..:||||:||.|:|.|.....:|:|:|.||||||||.:||.|.|:||:|:|.||||:||||||||
  Rat   108 VVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNL 172

  Fly   162 LLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSG 226
            ||.:||:|||||||||||..:..|.||..|||||:||::...||:|||||:|||||||.||||:.
  Rat   173 LLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRLEGTN 237

  Fly   227 VTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMI----WPLLKTPKSGAQTSIYAALDPELKNI 287
            ||||.||||:|.|.|.|:..      :....:|:.    |...|||..|||||||.|..|:::.:
  Rat   238 VTVNVLHPGIVRTNLGRHIH------IPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVEGV 296

  Fly   288 SGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGLDK 325
            ||.||.|||.:.:...|:|:.||:.||..||...|:.|
  Rat   297 SGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGILK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 147/293 (50%)
NADB_Rossmann 43..317 CDD:304358 145/288 (50%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 147/294 (50%)
NADB_Rossmann 44..326 CDD:304358 145/288 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.