DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and rdh13

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001011000.1 Gene:rdh13 / 496409 XenbaseID:XB-GENE-965068 Length:329 Species:Xenopus tropicalis


Alignment Length:305 Identity:160/305 - (52%)
Similarity:205/305 - (67%) Gaps:1/305 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKD 86
            |...||:|..||.........|:..||||||||||||||||:|:|||.:.:|||||.:||.|.:|
 Frog    17 GAILLKDYTGGGNCPSKASIIGQTVIVTGANTGIGKETALELAKRGGRIIMACRDMGKCENAARD 81

  Fly    87 IIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVN 151
            |..:|.|.|:|:|.|||:|..||::|......|:.::.||||||.|||||...|:|.:|:|.|||
 Frog    82 IRGKTLNHNVFARHLDLASSKSIKEFAKTIINEEERVDVLINNAAVMRCPHWKTEDNFEMQFGVN 146

  Fly   152 HIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSE-KSYDEGLAYSQSKLANVLFT 215
            |:||||||||||:.:|.|..|||:.||||||..|.|:..|||.| |.|:...||.||||||||||
 Frog   147 HLGHFLLTNLLLEKMKRSENSRIINVSSLAHIAGDIDFDDLNWEKKKYNTKAAYCQSKLANVLFT 211

  Fly   216 RELAKRLEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAAL 280
            .||||||:|:.:|.|:|||||.||||.|:....|:......|.|:.|.|:|:||..||.|:|.|:
 Frog   212 NELAKRLQGTKLTANSLHPGVADTELGRHTGMHQSAFSSTILAPLFWFLVKSPKQAAQPSVYLAV 276

  Fly   281 DPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGLDK 325
            ...|:.:||.||:..|.|..|..|||::.|:.||.||.|...|::
 Frog   277 AENLQGVSGKYFNALKEKEPAPQALDEESARKLWEESAKLVHLEE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 153/282 (54%)
NADB_Rossmann 43..317 CDD:304358 150/274 (55%)
rdh13NP_001011000.1 retinol-DH_like_SDR_c 38..313 CDD:212495 150/274 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2166
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 314 1.000 Inparanoid score I2520
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm48536
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.