DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and rdh12l

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001009912.1 Gene:rdh12l / 494176 ZFINID:ZDB-GENE-040801-48 Length:291 Species:Danio rerio


Alignment Length:272 Identity:153/272 - (56%)
Similarity:198/272 - (72%) Gaps:5/272 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            ||..::||||||||||||:::|:||..:.:|||||.:.|.|.|::...:.||::|...||||...
Zfish    13 GKTVLITGANTGIGKETAIDLAKRGARIIMACRDMEKAEAALKEVKDSSGNQDVFISSLDLSDSK 77

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPS 172
            |||.|.:...||:.::::||||||||.||...|.||:|:|:||||:||||||.||||::|.|||:
Zfish    78 SIRGFAEKINKEEKQVNILINNAGVMVCPYGKTADGFEMQIGVNHMGHFLLTYLLLDLIKRSAPA 142

  Fly   173 RIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVV 237
            ||:.|||.||..|:||:.|:||||:||:..||.|||||||||||.|||||||:|||..:||||||
Zfish   143 RIINVSSTAHQWGTINLEDINSEKNYDKQKAYCQSKLANVLFTRSLAKRLEGTGVTAYSLHPGVV 207

  Fly   238 DTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPKPVAS 302
            .|:|.|:.:..| ..|.:|.|    |..||...|||||||.|:||.|:..||.|:|||.|...|.
Zfish   208 QTDLWRHLSKPQ-QAVMWFTK----PFTKTSVQGAQTSIYCAVDPALQTESGKYYSDCAPAKAAK 267

  Fly   303 GALDDKVAKFLW 314
            .|:||:||:.||
Zfish   268 AAMDDEVAQRLW 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 153/272 (56%)
NADB_Rossmann 43..317 CDD:304358 153/272 (56%)
rdh12lNP_001009912.1 PRK06197 5..291 CDD:235737 153/272 (56%)
NADB_Rossmann 13..282 CDD:304358 153/272 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 254 1.000 Domainoid score I2017
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 304 1.000 Inparanoid score I2630
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - mtm6476
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.740

Return to query results.
Submit another query.