DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and sro

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:325 Identity:83/325 - (25%)
Similarity:128/325 - (39%) Gaps:89/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TIGVGIYFLKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEK 82
            ::|:|...||.            ::..|.::||.::|:|...|:..........::|....:.|.
  Fly    13 SLGLGRQQLKV------------DSRHVVLITGCDSGLGHSMAVYCHESLHMTVISCCHNIKSEG 65

  Fly    83 AR--------KDIIKETNNQNIFSRELDLSSLDSI----RKFVDGFKKEQP-KLHVLINNAGVMR 134
            |:        ||.:     ..:.:.||||...|||    |:..|...|:.. :|..|||||||| 
  Fly    66 AKLLQGLASAKDGL-----SRMHTLELDLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVM- 124

  Fly   135 C----PKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSE 195
            |    ...||:. .|.|:..|.:|...||:.||.:|:.. ..||:.|:|  |.            
  Fly   125 CFGEFEWQLTEQ-IEAQINCNLLGTMRLTHELLPLLRQQ-QGRIINVTS--HC------------ 173

  Fly   196 KSYDEGL-------AYSQSKLANVLFTRELAKRLEGSGVTVNALHPG--VVDTELARNWAFFQTN 251
                 ||       .|:.||.|...:|..|...|:..|:.|....||  |:|:.:|   |..|.:
  Fly   174 -----GLQALPALGPYAASKAALRFWTDSLRVELQQYGMEVVNFIPGSFVLDSNIA---ARQQQH 230

  Fly   252 LVKFFLKPMIWPLLKTPKSGAQTSIY----AALDPELKNISGLYFSDCKPKPVASGALDDKVAKF 312
            ..|          ::...|..|.::|    .|.:..||.:||.       ||......:..:|||
  Fly   231 AQK----------MREAFSAEQHALYDTYFEAFNGYLKVLSGF-------KPPNRLRNESLLAKF 278

  Fly   313  312
              Fly   279  278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 79/303 (26%)
NADB_Rossmann 43..317 CDD:304358 79/300 (26%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 79/299 (26%)
adh_short 28..229 CDD:278532 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.