DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and naz

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001287387.1 Gene:naz / 42204 FlyBaseID:FBgn0286852 Length:406 Species:Drosophila melanogaster


Alignment Length:332 Identity:119/332 - (35%)
Similarity:175/332 - (52%) Gaps:29/332 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WP--ATIGVGIYF-LKEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRD 76
            ||  |.:.|||.. ::..|.|.:...|.....::.:|||.|:|||.|.|..:|.|||.:.||||:
  Fly    18 WPTIAALTVGIVITVRTLMSGQRCPNDNQIKEQIVVVTGGNSGIGFEIAQALAGRGGRIILACRN 82

  Fly    77 MNRCEKARKDIIK-------------ETNNQN----IFSRELDLSSLDSIRKFVDGFKKEQPKLH 124
            :...::|.. |||             |.:|..    :.:|.|||.||.|:..|......|..::.
  Fly    83 LEAGKRAAA-IIKRELGCRTPLNSLDEDDNPEDRYFVEARYLDLCSLRSVHHFAGQLMAEFERID 146

  Fly   125 VLINNAGVMRCPKTL-TKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSIN 188
            ||:|||||:.....: |:||:|....||::..||||:|||..|:.|...||:.||:.||....|:
  Fly   147 VLVNNAGVVFANTQMPTEDGFERHSQVNYLAPFLLTHLLLPHLQRSEQGRILFVSAHAHQGAKID 211

  Fly   189 VAD-LN----SEKSYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGVV-DTELARNWAF 247
            ..| ||    |.| :....|::.|||..:|.||.:|:.|:|:.||||...||:| .|...||...
  Fly   212 FDDPLNVGTWSVK-FHAREAFAHSKLCVLLATRWMARELKGTSVTVNCCTPGLVRGTRHFRNSPL 275

  Fly   248 FQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKF 312
            ..:..||....|.:|..:|....|||.:|..|.||:||.::|.||:||:....:....|.::||.
  Fly   276 MSSLCVKAVTYPWMWLFMKNAYEGAQCAIRLATDPQLKEVTGEYFNDCEIAASSVTGQDKELAKK 340

  Fly   313 LWAESEK 319
            |:.::.|
  Fly   341 LYMQTIK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 110/304 (36%)
NADB_Rossmann 43..317 CDD:304358 109/297 (37%)
nazNP_001287387.1 FabG 47..318 CDD:223959 100/272 (37%)
retinol-DH_like_SDR_c_like 50..342 CDD:212492 108/293 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448981
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
98.900

Return to query results.
Submit another query.