DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and dhrs13l1

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_991211.1 Gene:dhrs13l1 / 402945 ZFINID:ZDB-GENE-040426-1907 Length:318 Species:Danio rerio


Alignment Length:314 Identity:147/314 - (46%)
Similarity:190/314 - (60%) Gaps:24/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YFL--KEYMQGGKFTKDTDETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKD 86
            ||:  :.::....||......||..||||.||||||.||..:|.||..|.||||...:.|:|.|:
Zfish    14 YFIVHRIFVHRKTFTGTAKLYGKTVIVTGGNTGIGKATATALAVRGARVILACRSKQKGEEAAKE 78

  Fly    87 IIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVN 151
            |..|:.|.::...:|||:|..|||.|.:.|.|.:|:|.:||||||:....:  |:||..:.||||
Zfish    79 IRTESGNDDVIFMQLDLASQKSIRSFAETFLKTEPRLDLLINNAGLAAAGR--TEDGIGMILGVN 141

  Fly   152 HIGHFLLTNLLLDVLKNSAPSRIVVVSSLAHARGSINVADLNSEK-----SYDEGL--AYSQSKL 209
            |||.||||||||:.||..||||:|.|||..|..|:|:...:|:.|     |.|..|  ||:.|||
Zfish   142 HIGPFLLTNLLLERLKECAPSRVVNVSSCGHDLGTIDFDCINTHKKLGLGSSDGDLFRAYTHSKL 206

  Fly   210 ANVLFTRELAKRLEGSGVTVNALHPGVVDTELARN---W--AFFQTNLVKFFLKPMIWPLLKTPK 269
            .|||||.||||||||:.||..:||||.|.:||.|:   |  ....|.:.|||        ...|.
Zfish   207 CNVLFTHELAKRLEGTNVTCYSLHPGSVRSELGRDITEWHARVLLTVVSKFF--------ATDPV 263

  Fly   270 SGAQTSIYAALDPELKNISGLYFSDCKPKPVASGALDDKVAKFLWAESEKWTGL 323
            |||||::|.:|...::::||.|||||:...|.:.|.||.|||.||..|||..|:
Zfish   264 SGAQTTLYCSLQDGIEHLSGRYFSDCQLVQVKAEARDDGVAKKLWEVSEKLCGM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 142/293 (48%)
NADB_Rossmann 43..317 CDD:304358 139/285 (49%)
dhrs13l1NP_991211.1 PRK06197 35..316 CDD:235737 142/290 (49%)
NADB_Rossmann 35..311 CDD:304358 139/285 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.