DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and wwox

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_957207.1 Gene:wwox / 393887 ZFINID:ZDB-GENE-040426-858 Length:412 Species:Danio rerio


Alignment Length:293 Identity:123/293 - (41%)
Similarity:174/293 - (59%) Gaps:23/293 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DETGKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLS 104
            |.:.||.||||||:|||.|||...|..|..|.||||:.:|..||...|:.|.:...:....|||:
Zfish   118 DLSDKVIIVTGANSGIGFETARSFALHGAHVILACRNQSRASKAASLIMGEWSKARVEVLPLDLA 182

  Fly   105 SLDSIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNS 169
            ||.|:|:|.:.||..:..||||:.||.|...|..||:||:|....:.|:|||||..||.|||:.|
Zfish   183 SLRSVRQFAELFKATKLPLHVLVCNAAVCSQPWRLTEDGFESTFQICHLGHFLLVQLLQDVLRLS 247

  Fly   170 APSRIVVVSSLAH-------ARGSINVADLNS--EKSYDEGLAYSQSKLANVLFTRELAKRLEGS 225
            ||:|:|||||.:|       :.|:::: ||.|  :|:|...|||:::||.|:||:.||.:|:...
Zfish   248 APARVVVVSSESHRFTDLLDSCGNLDL-DLLSPPQKNYWSLLAYNRAKLCNLLFSSELHRRMSPH 311

  Fly   226 GVTVNALHPG-VVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISG 289
            |:..|||||| ::.|.:.|:|....      .|..:..|..|:.:.||.|::|.|:.|||:.|.|
Zfish   312 GICCNALHPGSMMFTSIHRSWWLLT------LLFSLARPFTKSMQQGAATTVYCAVAPELEGIGG 370

  Fly   290 LYFSD---CKPKPVASGALDDKVAKFLWAESEK 319
            :||::   |.|.|.|.   |...|..||..||:
Zfish   371 MYFNNCFRCLPSPQAQ---DPAAALSLWELSER 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 123/293 (42%)
NADB_Rossmann 43..317 CDD:304358 120/286 (42%)
wwoxNP_957207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 18..47 CDD:278809
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 59..88 CDD:278809
PRK06196 108..402 CDD:235736 123/293 (42%)
human_WWOX_like_SDR_c-like 121..404 CDD:187669 122/290 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.