DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and zgc:64106

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_956671.1 Gene:zgc:64106 / 393348 ZFINID:ZDB-GENE-040426-1370 Length:309 Species:Danio rerio


Alignment Length:267 Identity:128/267 - (47%)
Similarity:169/267 - (63%) Gaps:15/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GKVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            ||..|||||||||||..||:.||||..|.||||...|...|.|:|.:.|.|.::..|.||.||::
Zfish    30 GKTAIVTGANTGIGKFIALDFARRGARVILACRSEARGTAALKEIRESTGNHDVHLRLLDTSSME 94

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPS 172
            |:|||.....||:.:||:|:||||....|..:|.||.|:....||:|.||||:||||:||.|||:
Zfish    95 SVRKFAAQILKEEKELHILVNNAGASGLPIQITADGLEITFATNHVGPFLLTSLLLDLLKKSAPA 159

  Fly   173 RIVVVSSLAHARGSINVADLNSEK-SYDEGLAYSQSKLANVLFTRELAKRLEGSGVTVNALHPGV 236
            |||.|:|..|.:|.::.|..:.|| ::.....|:.:||.||::|.|||:||:|:|||.|:|||||
Zfish   160 RIVNVASAMHWKGDVDFAHFHGEKLNHGVNRVYNHTKLHNVIWTNELARRLQGTGVTANSLHPGV 224

  Fly   237 VDTELARNWAFFQT---NLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYF-SDCK- 296
            |.||:.||:.|...   ||:.||       ..||.:.||.:.||.|:..|.:.|:|.|| |||. 
Zfish   225 VMTEVMRNYNFILRLLFNLIGFF-------FFKTAEEGAFSPIYCAVAEENEGITGKYFDSDCSL 282

  Fly   297 --PKPVA 301
              |.|.|
Zfish   283 VLPAPPA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 128/267 (48%)
NADB_Rossmann 43..317 CDD:304358 128/267 (48%)
zgc:64106NP_956671.1 PRK06197 29..305 CDD:235737 128/267 (48%)
NADB_Rossmann 30..291 CDD:304358 128/267 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.