powered by:
Protein Alignment CG2064 and C2orf81
DIOPT Version :9
Sequence 1: | NP_610310.2 |
Gene: | CG2064 / 35708 |
FlyBaseID: | FBgn0033205 |
Length: | 330 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303693.1 |
Gene: | C2orf81 / 388963 |
HGNCID: | 34350 |
Length: | 615 |
Species: | Homo sapiens |
Alignment Length: | 47 |
Identity: | 10/47 - (21%) |
Similarity: | 17/47 - (36%) |
Gaps: | 14/47 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 222 LEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTP 268
|..|.:.....||.:.|...:|: |.:||.::.|
Human 472 LPNSRIRFLTTHPVLPDVARSRS--------------PKLWPSVRWP 504
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1208 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.