DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and C2orf81

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001303693.1 Gene:C2orf81 / 388963 HGNCID:34350 Length:615 Species:Homo sapiens


Alignment Length:47 Identity:10/47 - (21%)
Similarity:17/47 - (36%) Gaps:14/47 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 LEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTP 268
            |..|.:.....||.:.|...:|:              |.:||.::.|
Human   472 LPNSRIRFLTTHPVLPDVARSRS--------------PKLWPSVRWP 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 10/47 (21%)
NADB_Rossmann 43..317 CDD:304358 10/47 (21%)
C2orf81NP_001303693.1 DUF4639 9..614 CDD:292118 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.