DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2064 and cbr1

DIOPT Version :9

Sequence 1:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:294 Identity:87/294 - (29%)
Similarity:123/294 - (41%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KVFIVTGANTGIGKETALEIARR-GGTVYLACRDMNRCEKARKDIIKETNNQNIFSRELDLSSLD 107
            ||.:|||||.|||......:.:. .|.|||:.||:.| ..|..|.:|:.....:| .:||::..:
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGR-GTAAVDSLKKEGLHPLF-HQLDINDPN 67

  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDG--YELQLGVNHIGHFLLTNLLLDVLKNSA 170
            |:|...|.|:::...|.|||||||:.......|..|  .::.|..|......:.|:.|.::|.. 
Zfish    68 SVRTARDFFQEKYGGLDVLINNAGIAFKMADTTPFGTQADVTLKTNFFATRDMCNVFLPIIKPG- 131

  Fly   171 PSRIVVVS----SLAHARGS-----------INVADLN---------------SEKSYDEGLAYS 205
             .|:|.||    |:|..|.|           |...:||               ||:.: ...||.
Zfish   132 -GRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSERGW-PSTAYG 194

  Fly   206 QSKLANVLFT----RELAKRLEGSGVTVNALHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLK 266
            .||......|    |.|.|...|.|:..||..||.|.|::|...|                  .|
Zfish   195 ISKTGLTTLTRIQARNLTKERPGDGILCNACCPGWVRTDMAGPNA------------------TK 241

  Fly   267 TPKSGAQTSIYAALDPE-LKNISGLYFSDCKPKP 299
            :|..||.|.:|.||.|. .|...|.:.|:.|.:|
Zfish   242 SPDEGAITPVYLALLPAGAKEPHGQFVSEMKVQP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 87/294 (30%)
NADB_Rossmann 43..317 CDD:304358 87/294 (30%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 87/294 (30%)
adh_short 5..237 CDD:278532 72/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.